Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM24 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Tripartite motif containing 24

Gene Aliases

E3 ubiquitin-protein ligase TRIM24; hTIF1; PTC6; RING finger protein 82; RING-type E3 ubiquitin transferase TIF1-alpha; RNF82; TF1A; TIF1; TIF1A; TIF1-alpha; TIF1ALPHA; transcription intermediary factor 1-alpha; transcriptional intermediary factor 1; Tripartite motif-containing protein 24.

Gene ID

8805

Accession Number

NP_003843.3

Reactivity

Homo sapiens|Human

Target

Transcriptional coactivator that interacts with numerous nuclear receptors and coactivators and modulates the transcription of target genes. Interacts with chromatin depending on histone H3 modifications, having the highest affinity for histone H3 that is both unmodified at 'Lys-4' (H3K4me0) and acetylated at 'Lys-23' (H3K23ac) . Has E3 protein-ubiquitin ligase activity. Promotes ubiquitination and proteasomal degradation of p53/TP53. Plays a role in the regulation of cell proliferation and apoptosis, at least in part via its effects on p53/TP53 levels. Up-regulates ligand-dependent transcription activation by AR, GCR/NR3C1, thyroid hormone receptor (TR) and ESR1. Modulates transcription activation by retinoic acid (RA) receptors, including RARA. Plays a role in regulating retinoic acid-dependent proliferation of hepatocytes (By similarity) .

Type

Protein

Source

Yeast

Sequence

KKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYPEKRFPK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

16.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

TRIM24

Host or Source

Human

Protein Name

Transcription intermediary factor 1-alpha

Gene Name URL

TRIM24

Nucleotide Accession Number

NM_003852.3

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL8 (Interleukin 8, CXCL8, GCP-1, GCP1, LECT, LUCT, LYNAP, MDNCF, MONAP, NAF, NAP-1, NAP1) (APC)
MBS6167157-01 0.1 mL

IL8 (Interleukin 8, CXCL8, GCP-1, GCP1, LECT, LUCT, LYNAP, MDNCF, MONAP, NAF, NAP-1, NAP1) (APC)

Sign In for Pricing
View Details
IL8 (Interleukin 8, CXCL8, GCP-1, GCP1, LECT, LUCT, LYNAP, MDNCF, MONAP, NAF, NAP-1, NAP1) (APC)
MBS6167157-02 5x 0.1 mL

IL8 (Interleukin 8, CXCL8, GCP-1, GCP1, LECT, LUCT, LYNAP, MDNCF, MONAP, NAF, NAP-1, NAP1) (APC)

Sign In for Pricing
View Details
LIN28 (42-209, His-tag) Human Protein
AR09295PU-L 250 µg

LIN28 (42-209, His-tag) Human Protein

Sign In for Pricing
View Details
Tissue, Section, Human Disease, Lupus, Spinal cord (Frozen)
MBS640776-01 5 Sections

Tissue, Section, Human Disease, Lupus, Spinal cord (Frozen)

Sign In for Pricing
View Details
Tissue, Section, Human Disease, Lupus, Spinal cord (Frozen)
MBS640776-02 5x 5 Sections

Tissue, Section, Human Disease, Lupus, Spinal cord (Frozen)

Sign In for Pricing
View Details
Human Serine/Threonine-Protein Phosphatase 2A 56 kDa Regulatory Subunit Alpha Isoform ELISA Kit
IHUPP2AAKT 1 Each

Human Serine/Threonine-Protein Phosphatase 2A 56 kDa Regulatory Subunit Alpha Isoform ELISA Kit

Sign In for Pricing
View Details