Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TGFA Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

EGF-like TGF ETGF TGF type 1

Reactivity

Ovis aries|Sheep

Target

TGF alpha is a mitogenic polypeptide that is able to bind to the EGF receptor/EGFR and to act synergistically with TGF beta to promote anchorage-independent cell proliferation in soft agar.

Type

Protein

Source

Yeast

Sequence

ENSTSALSDPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLLQEEKPACVCHSGYVGARCEHADLLAVVAASQKKQ

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

34.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

TGFA

Host or Source

Sheep

Protein Name

Protransforming growth factor alpha

Gene Name URL

TGFA

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sod2 Rabbit Polyclonal Antibody
TA326596 100 µg

Sod2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cytomegalovirus Immediate/Early Antigen (CMV, HCMV, Human Herpes virus 5, HHV-5, HHV5) (MaxLight 490)
C9098-46-ML490 100 µL

Cytomegalovirus Immediate/Early Antigen (CMV, HCMV, Human Herpes virus 5, HHV-5, HHV5) (MaxLight 490)

Sign In for Pricing
View Details
P15/p17/p47, Recombinant, T. pallidum discontinued. see 471457
397283 1 mg

P15/p17/p47, Recombinant, T. pallidum discontinued. see 471457

Sign In for Pricing
View Details
Hda1 (E-9) FITC
sc-393814 FITC 200 µg/mL

Hda1 (E-9) FITC

Sign In for Pricing
View Details
Mgst1 Rat siRNA Oligo Duplex (Locus ID 171341)
SR508561 1 Kit

Mgst1 Rat siRNA Oligo Duplex (Locus ID 171341)

Sign In for Pricing
View Details
Propyl-β-D-glucuronide, 10 mg
0903-10 10 mg

Propyl-β-D-glucuronide, 10 mg

Sign In for Pricing
View Details