Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFPI Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Tissue factor pathway inhibitor

Gene Aliases

EPI; extrinsic pathway inhibitor; LACI; lipoprotein-associated coagulation inhibitor; tissue factor pathway inhibitor; tissue factor pathway inhibitor (lipoprotein-associated coagulation inhibitor) .

Gene ID

100009401

Accession Number

NP_001095184.1

Reactivity

Oryctolagus cuniculus|Rabbit

Target

Inhibits factor X (X (a) ) directly and, in a Xa-dependent way, inhibits VIIa/tissue factor activity, presumably by forming a quaternary Xa/LACI/VIIa/TF complex. It possesses an antithrombotic action and also the ability to associate with lipoproteins in plasma.

Type

Protein

Source

Yeast

Sequence

AAEEDEEFTNITDIKPPLQKPTHSFCAMKVDDGPCRAYIKRFFFNILTHQCEEFIYGGCEGNENRFESLEECKEKCARDYPKMTTKLTFQKGKPDFCFLEEDPGICRGYITRYFYNNQSKQCERFKYGGCLGNLNNFESLEECKNTCENPTSDFQVDDHRTQLNTVNNTLINQPTKAPRRWAFHGPSWCLPPADRGLCQANEIRFFYNAIIGKCRPFKYSGCGGNENNFTSKKACITACKKGFIPKSIKGGLIKTKRKKKKQPVKITYVETFVKKT

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

33.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

TFPI

Host or Source

Rabbit

Protein Name

Tissue factor pathway inhibitor

Gene Name URL

TFPI

Nucleotide Accession Number

NM_001101714.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SF1 Antibody - N-terminal region : HRP (ARP33492_P050-HRP)
ARP33492_P050-HRP 100 µL

SF1 Antibody - N-terminal region : HRP (ARP33492_P050-HRP)

Sign In for Pricing
View Details
Biotin Linked Monoclonal Antibody to Squamous Cell Carcinoma Antigen 1/2 (SCCA1/SCCA2)
MBS2133918-01 0.1 mL

Biotin Linked Monoclonal Antibody to Squamous Cell Carcinoma Antigen 1/2 (SCCA1/SCCA2)

Sign In for Pricing
View Details
Biotin Linked Monoclonal Antibody to Squamous Cell Carcinoma Antigen 1/2 (SCCA1/SCCA2)
MBS2133918-02 0.2 mL

Biotin Linked Monoclonal Antibody to Squamous Cell Carcinoma Antigen 1/2 (SCCA1/SCCA2)

Sign In for Pricing
View Details
Biotin Linked Monoclonal Antibody to Squamous Cell Carcinoma Antigen 1/2 (SCCA1/SCCA2)
MBS2133918-03 0.5 mL

Biotin Linked Monoclonal Antibody to Squamous Cell Carcinoma Antigen 1/2 (SCCA1/SCCA2)

Sign In for Pricing
View Details
Biotin Linked Monoclonal Antibody to Squamous Cell Carcinoma Antigen 1/2 (SCCA1/SCCA2)
MBS2133918-04 1 mL

Biotin Linked Monoclonal Antibody to Squamous Cell Carcinoma Antigen 1/2 (SCCA1/SCCA2)

Sign In for Pricing
View Details
Biotin Linked Monoclonal Antibody to Squamous Cell Carcinoma Antigen 1/2 (SCCA1/SCCA2)
MBS2133918-05 5 mL

Biotin Linked Monoclonal Antibody to Squamous Cell Carcinoma Antigen 1/2 (SCCA1/SCCA2)

Sign In for Pricing
View Details