Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCN1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Cobalophilin; Haptocorrin; Protein R; Transcobalamin I.

Reactivity

Porcine|Sus scrofa

Target

Binds vitamin B12 with femtomolar affinity and protects it from the acidic environment of the stomach (By similarity) . Binds to cobalamin and to cobalamin analogs such as cobinamide.

Type

Protein

Source

Yeast

Sequence

CVVSEKDYSHLRLLISAMDNLEQIRGIYGASILLSQRLAGIQNPSLEEELSQRIQDDMNRRDMSNLTSGQLALIILAFGACKTPDVRFIHDHHLVEKLGEKFKEEIKNMEIHNSNPLTNYYQLSFDVLTLCLFRGNYSISNVTHYFNPENKNFNLSGHFSVDTGAVAVLALTCVKRSISNGKIKAAIKDSDTIQKYIESLVHKIQSEKMVVSLETRIAQEKLCRLSLSHQTITKMNQIAKKLWTRCLTHSQGVFRLPIAAAQILPALLGKTYLDVTKLLLVPKVQVNITDEPVPVVPTLSPENISVIYCVKINEISNCINITVFLDVMKAAQEKNSTIYGFTMTETPWGPYITSVQGIWANNNERTYWEHSEQQQITKPRSMGIMLSKMESI

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

46.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

TCN1

Host or Source

Pig

Protein Name

Transcobalamin-1

Gene Name URL

TCN1

More Discoveries

Explore Other Products

Browse additional items from our catalog

PFN1P4 Protein Lysate (Human) with C-Ha Tag
36445031 100 µg

PFN1P4 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Horse Very Late Appearing Antigen 4 ELISA Kit
MBS047321-01 48 Well

Horse Very Late Appearing Antigen 4 ELISA Kit

Sign In for Pricing
View Details
Horse Very Late Appearing Antigen 4 ELISA Kit
MBS047321-02 96 Well

Horse Very Late Appearing Antigen 4 ELISA Kit

Sign In for Pricing
View Details
Horse Very Late Appearing Antigen 4 ELISA Kit
MBS047321-03 5x 96 Well

Horse Very Late Appearing Antigen 4 ELISA Kit

Sign In for Pricing
View Details
Horse Very Late Appearing Antigen 4 ELISA Kit
MBS047321-04 10x 96 Well

Horse Very Late Appearing Antigen 4 ELISA Kit

Sign In for Pricing
View Details
MAGEA2, NT (Melanoma-associated Antigen 2, MAGE-2 Antigen, Cancer/Testis Antigen 1.2, CT1.2, MAGE2, MAGEA2A) (APC)
MBS6486210-01 0.2 mL

MAGEA2, NT (Melanoma-associated Antigen 2, MAGE-2 Antigen, Cancer/Testis Antigen 1.2, CT1.2, MAGE2, MAGEA2A) (APC)

Sign In for Pricing
View Details