Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPT15 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

TATA-binding protein

Gene Aliases

BTF1; TATA sequence-binding protein; TATA-binding factor; TATA-binding protein; TATA-box factor; TBP1; Transcription factor D; Transcription initiation factor TFIID TBP subunit; YER148W.

Gene ID

856891

Accession Number

NP_011075.3

Reactivity

Saccharomyces cerevisiae

Target

General transcription factor that functions at the core of the DNA-binding general transcription factor complex TFIID. Binding of TFIID to a promoter (with or without TATA element) is the initial step in preinitiation complex (PIC) formation. TFIID plays a key role in the regulation of gene expression by RNA polymerase II through different activities such as transcription activator interaction, core promoter recognition and selectivity, TFIIA and TFIIB interaction, chromatin modification (histone acetylation by TAF1), facilitation of DNA opening and initiation of transcription.

Type

Protein

Source

Yeast

Sequence

ADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAAPESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAAKFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

28.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

SPT15

Host or Source

Yeast

Protein Name

TATA-box-binding protein

Gene Name URL

SPT15

Nucleotide Accession Number

NM_001179038.3

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rebamipide impurity 1
HY-Z0629-01 50 mg

Rebamipide impurity 1

Sign In for Pricing
View Details
Rebamipide impurity 1
HY-Z0629-02 100 mg

Rebamipide impurity 1

Sign In for Pricing
View Details
Rebamipide impurity 1
HY-Z0629-03 250 mg

Rebamipide impurity 1

Sign In for Pricing
View Details
Rebamipide impurity 1
HY-Z0629-04 500 mg

Rebamipide impurity 1

Sign In for Pricing
View Details
Rebamipide impurity 1
HY-Z0629-05 1 g

Rebamipide impurity 1

Sign In for Pricing
View Details
Rebamipide impurity 1
HY-Z0629-06 5 g

Rebamipide impurity 1

Sign In for Pricing
View Details