Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sort1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Sortilin 1

Gene Aliases

Glycoprotein 110; gp110; neurotensin receptor 3; Nt3; NTR3; Nts3; sortilin.

Gene ID

83576

Accession Number

NP_113955.1

Reactivity

Rat|Rattus norvegicus

Target

Functions as a sorting receptor in the Golgi compartment and as a clearance receptor on the cell surface. Required for protein transport from the Golgi apparatus to the lysosomes by a pathway that is independent of the mannose-6-phosphate receptor (M6PR) . Also required for protein transport from the Golgi apparatus to the endosomes. Promotes neuronal apoptosis by mediating endocytosis of the proapoptotic precursor forms of BDNF (proBDNF) and NGFB (proNGFB) . Also acts as a receptor for neurotensin. May promote mineralization of the extracellular matrix during osteogenic differentiation by scavenging extracellular LPL. Probably required in adipocytes for the formation of specialized storage vesicles containing the glucose transporter SLC2A4/GLUT4 (GLUT4 storage vesicles, or GSVs) . These vesicles provide a stable pool of SLC2A4 and confer increased responsiveness to insulin. May also mediate transport from the endoplasmic reticulum to the Golgi.

Type

Protein

Source

Yeast

Sequence

CEENDYTTWLAHSTDPGDYKDGCILGYKEQFLRLRKSSVCQNGRDYVVAKQPSICPCSLEDFLCDFGYFRPENASECVEQPELKGHELEFCLYGKEEHLTTNGYRKIPGDRCQGGMNPAREVKDLKKKCTSNFLNPKKQNSKSSS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

18.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Sort1

Host or Source

Rat

Protein Name

Sortilin

Gene Name URL

Sort1

Nucleotide Accession Number

NM_031767.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ribonuclease Inhibitor (RNH1) (NM_203388) Human Over-expression Lysate
LC404329 20 µg

Ribonuclease Inhibitor (RNH1) (NM_203388) Human Over-expression Lysate

Sign In for Pricing
View Details
S100B Antibody (HRP)
KH-111-01 50 μL

S100B Antibody (HRP)

Sign In for Pricing
View Details
S100B Antibody (HRP)
KH-111-02 100 µL

S100B Antibody (HRP)

Sign In for Pricing
View Details
S100B Antibody (HRP)
KH-111-03 1 mL

S100B Antibody (HRP)

Sign In for Pricing
View Details
ABCG2 Antibody (BCRP)
F44284-0.08ML 0.08 mL

ABCG2 Antibody (BCRP)

Sign In for Pricing
View Details
Cytokeratin 20 (KRT20) Rabbit Polyclonal Antibody
AP06202PU-N 100 µg

Cytokeratin 20 (KRT20) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details