Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNCA Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Synuclein alpha

Gene Aliases

Alpha-synuclein; Non-A beta component of AD amyloid; synuclein, alpha (non A4 component of amyloid precursor) .

Gene ID

102119369

Reactivity

Cynomolgus Monkey|Macaca fascicularis

Target

May be involved in the regulation of dopamine release and transport.

Type

Protein

Source

Yeast

Sequence

MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFIKKDQLGKNEEGAPQEGILQDMPVDPDNEAYEMPSEEGYQDYEPEA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

16.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

SNCA

Host or Source

Macaca fascicularis

Protein Name

Alpha-synuclein

Gene Name URL

SNCA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM31 CRISPR/Cas9 KO Plasmid (h)
sc-411560 20 µg

TRIM31 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
ATRN sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0157305 3x 1.0 µg

ATRN sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
PDS5A, CT (PDS5A, KIAA0648, PDS5, Sister chromatid cohesion protein PDS5 homolog A, Cell proliferation-inducing gene 54 protein, Sister chromatid cohesion protein 112) (MaxLight 405) discontinued
039856-ML405 100 µL

PDS5A, CT (PDS5A, KIAA0648, PDS5, Sister chromatid cohesion protein PDS5 homolog A, Cell proliferation-inducing gene 54 protein, Sister chromatid cohesion protein 112) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Mouse Monoclonal MEK2 Antibody (OTI8G6) [DyLight 488]
NBP2-72646G 0.1 mL

Mouse Monoclonal MEK2 Antibody (OTI8G6) [DyLight 488]

Sign In for Pricing
View Details
Phospho-AMPKα1 (Ser496) Antibody [K3H21]
C20640-100uL 100 µL

Phospho-AMPKα1 (Ser496) Antibody [K3H21]

Sign In for Pricing
View Details
IGFBP1 (14E18) Rabbit Monoclonal Antibody
E28M6242 100 µL

IGFBP1 (14E18) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details