What is the catalog number for Serpina1 Recombinant Protein?

The catalog number for Serpina1 Recombinant Protein is OPCA02785-20UG.

What sizes are available for Serpina1 Recombinant Protein?

Serpina1 Recombinant Protein is available in the following size(s): 20 µg.

Is Serpina1 Recombinant Protein in stock?

Serpina1 Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

Serpina1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Serpin family A member 1

Gene Aliases

AAT; alpha-1-antiproteinase; Alpha-1-antitrypsin; alpha-1-antitrypsin (protease inhibitor) ; alpha-1-protease inhibitor; alpha-1-proteinase inhibitor; Pi; serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1; serine (or cysteine) proteinase inhibitor, clade A, member 1; serine protease inhibitor alpha 1; serpin A1; serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1; Spi1.

Gene ID

24648

Accession Number

NP_071964.2

Reactivity

Rat|Rattus norvegicus

Target

Inhibitor of serine proteases. The primary target is elastase, but also has a moderate affinity for plasmin and thrombin.

Type

Protein

Source

Yeast

Sequence

EDAQETDTSQQDQSPTYRKISSNLADFAFSLYRELVHQSNTSNIFFSPMSITTAFAMLSLGSKGDTRKQILEGLEFNLTQIPEADIHKAFHHLLQTLNRPDSELQLNTGNGLFVNKNLKLVEKFLEEVKNNYHSEAFSVNFADSEEAKKVINDYVEKGTQGKIVDLMKQLDEDTVFALVNYIFFKGKWKRPFNPEHTRDADFHVDKSTTVKVPMMNRLGMFDMHYCSTLSSWVLMMDYLGNATAIFLLPDDGKMQHLEQTLTKDLISRFLLNRQTRSAILYFPKLSISGTYNLKTLLSSLGITRVFNNDADLSGITEDAPLKLSQAVHKAVLTLDERGTEAAGATVVEAVPMSLPPQVKFDHPFIFMIVESETQSPLFVGKVIDPTR

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.