Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SAA1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Amyloid fibril protein AACurated

Reactivity

Cat|Felis catus

Target

Major acute phase reactant. Apolipoprotein of the HDL complex.

Type

Protein

Source

Yeast

Sequence

EWYSFLGEAAQGAWDMWRAYSDMREANYIGADKYFHARGNYDAAQRGPGGAWAAKVISDARENSQRVTDFFRHGNSGHGAEDSKADQEWG

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

12.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

SAA1

Host or Source

Cat

Protein Name

Serum amyloid A protein

Gene Name URL

SAA1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Laminin 5 (LAMB3) (NM_001127641) Human Over-expression Lysate
LY426828 100 µg

Laminin 5 (LAMB3) (NM_001127641) Human Over-expression Lysate

Sign In for Pricing
View Details
BetterBox™ Microtube Storage Boxes
R1081-A 5 Units/Pack

BetterBox™ Microtube Storage Boxes

Sign In for Pricing
View Details
Tissue Protein Lysate, Kidney
CP565439 150 µg

Tissue Protein Lysate, Kidney

Sign In for Pricing
View Details
14-3-3E / Tryptophan 5-Monooxygenase (CPTC-YWHAE-1), Biotin conjugate, 0.1mg/mL
BNCB2231-500 1x 500 µL

14-3-3E / Tryptophan 5-Monooxygenase (CPTC-YWHAE-1), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MTAP (Tumor Suppressor Marker) (rMTAP/1813), CF640R conjugate, 0.1mg/mL
BNC403646-500 1x 500 µL

MTAP (Tumor Suppressor Marker) (rMTAP/1813), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human E2F Transcription Factor 3 (E2F3) ELISA Kit
RD-E2F3-Hu-01 96 Tests

Human E2F Transcription Factor 3 (E2F3) ELISA Kit

Sign In for Pricing
View Details