Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Reg3g Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Regenerating islet-derived 3 gamma

Gene Aliases

AI449515; generating islet-derived, mouse homolog 3 gamma; pancreatitis-associated protein 3; reg III-gamma; REG-3-gamma; regenerating islet-derived protein 3-gamma; regenerating islet-derived protein III-gamma.

Gene ID

19695

Accession Number

NP_035390.1

Reactivity

Mouse|Mus musculus

Target

Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Restricts bacterial colonization of the intestinal epithelial surface and consequently limits activation of adaptive immune responses by the microbiota. The uncleaved form has bacteriostatic activity, whereas the cleaved form has bactericidal activity against L.monocytogenes and methicillin-resistant S.aureus. Regulates keratinocyte proliferation and differentiation after skin injury.

Type

Protein

Source

Yeast

Sequence

EVAKKDAPSSRSSCPKGSRAYGSYCYALFSVSKNWYDADMACQKRPSGHLVSVLSGAEASFLSSMIKSSGNSGQYVWIGLHDPTLGYEPNRGGWEWSNADVMNYINWETNPSSSSGNHCGTLSRASGFLKWRENYCNLELPYVCKFKA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

18.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Reg3g

Host or Source

Mouse

Protein Name

Regenerating islet-derived protein 3-gamma

Gene Name URL

Reg3g

Nucleotide Accession Number

NM_011260.1

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD62p Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-43529R-BF647 100 µL

CD62p Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Recombinant Mouse TTC26 Protein, His (Fc)-Avi-tagged
TTC26-9716M 50 µg

Recombinant Mouse TTC26 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Recombinant Human C21orf91 Protein
E30P7081 20 µg

Recombinant Human C21orf91 Protein

Sign In for Pricing
View Details
Anti-Mouse Thy-1.2/CD90.2 Antibody (30-H12), FITC
FMC07811 100 Tests

Anti-Mouse Thy-1.2/CD90.2 Antibody (30-H12), FITC

Sign In for Pricing
View Details
SNRPB (NM_003091) Human Over-expression Lysate
LC418902 20 µg

SNRPB (NM_003091) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human Putative uncharacterized protein C3orf74 (C3orf74)
MBS1324993-01 0.02 mg (E-Coli)

Recombinant Human Putative uncharacterized protein C3orf74 (C3orf74)

Sign In for Pricing
View Details