Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Reg3g Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Regenerating islet-derived 3 gamma

Gene Aliases

AI449515; generating islet-derived, mouse homolog 3 gamma; pancreatitis-associated protein 3; reg III-gamma; REG-3-gamma; regenerating islet-derived protein 3-gamma; regenerating islet-derived protein III-gamma.

Gene ID

19695

Accession Number

NP_035390.1

Reactivity

Mouse|Mus musculus

Target

Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Restricts bacterial colonization of the intestinal epithelial surface and consequently limits activation of adaptive immune responses by the microbiota. The uncleaved form has bacteriostatic activity, whereas the cleaved form has bactericidal activity against L.monocytogenes and methicillin-resistant S.aureus. Regulates keratinocyte proliferation and differentiation after skin injury.

Type

Protein

Source

Yeast

Sequence

EVAKKDAPSSRSSCPKGSRAYGSYCYALFSVSKNWYDADMACQKRPSGHLVSVLSGAEASFLSSMIKSSGNSGQYVWIGLHDPTLGYEPNRGGWEWSNADVMNYINWETNPSSSSGNHCGTLSRASGFLKWRENYCNLELPYVCKFKA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

18.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Reg3g

Host or Source

Mouse

Protein Name

Regenerating islet-derived protein 3-gamma

Gene Name URL

Reg3g

Nucleotide Accession Number

NM_011260.1

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal TIGD1 Antibody (OTI4G9) [DyLight 350]
NBP2-74519UV 0.1 mL

Mouse Monoclonal TIGD1 Antibody (OTI4G9) [DyLight 350]

Sign In for Pricing
View Details
GluR1,2 delta (Glutamate Receptor) (AP) discontinued
G3500-10A-AP 100 µL

GluR1,2 delta (Glutamate Receptor) (AP) discontinued

Sign In for Pricing
View Details
Recombinant Atropa belladonna NAD (P)H-quinone oxidoreductase subunit 1, chloroplastic (ndhA), partial
MBS7097229 Inquire

Recombinant Atropa belladonna NAD (P)H-quinone oxidoreductase subunit 1, chloroplastic (ndhA), partial

Sign In for Pricing
View Details
GCLM (NM_002061) Human Over-expression Lysate
LS002730 100 µg

GCLM (NM_002061) Human Over-expression Lysate

Sign In for Pricing
View Details
AFF2 (AF4/FMR2 Family, Member 2, FMR2, FRAXE, MRX2, OX19) (AP)
MBS6165515-01 0.1 mL

AFF2 (AF4/FMR2 Family, Member 2, FMR2, FRAXE, MRX2, OX19) (AP)

Sign In for Pricing
View Details
AFF2 (AF4/FMR2 Family, Member 2, FMR2, FRAXE, MRX2, OX19) (AP)
MBS6165515-02 5x 0.1 mL

AFF2 (AF4/FMR2 Family, Member 2, FMR2, FRAXE, MRX2, OX19) (AP)

Sign In for Pricing
View Details