Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PZP Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

C3 and PZP-like alpha-2-macroglobulin domain-containing protein 6.

Reactivity

Homo sapiens|Human

Target

Is able to inhibit all four classes of proteinases by a unique 'trapping' mechanism. This protein has a peptide stretch, called the 'bait region' which contains specific cleavage sites for different proteinases. When a proteinase cleaves the bait region, a conformational change is induced in the protein which traps the proteinase. The entrapped enzyme remains active against low molecular weight substrates (activity against high molecular weight substrates is greatly reduced) . Following cleavage in the bait region a thioester bond is hydrolyzed and mediates the covalent binding of the protein to the proteinase.

Type

Protein

Source

Yeast

Sequence

MKPEAELSVSSVYNLLTVKDLTNFPDNVDQQEEEQGHCPRPFFIHNGAIYVPLSSNEADIYSFLKGMGLKVFTNSKIRKPKSCSVIPSVSAGAVGQGYYGAGLGVVERPYVPQLGTYNVIPLNNEQSSGPVPETVRSYFPETWIWELVAVNSSGVAEVGVTVPDTITEWKAGAFCLSEDAGLGISSTASLRAFQPFFVELTMPYSVIRGEVFTLKATVLNYLPKCIRAEGIEQEKTFSSMTCASGANVSEQLSLKLPSNVVKESARASFSVLGDILGSAMQNIQNLLQMPYGCGEQNMVLFAPNIYVLNYLNETQQLTQEIKAKAVGYLITGYQRQLNYKHQDGSYSTFG

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

65.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PZP

Host or Source

Human

Protein Name

Pregnancy zone protein

Gene Name URL

PZP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD142 (Tissue factor)
100-158a-L100 100 µg

CD142 (Tissue factor)

Sign In for Pricing
View Details
MCC (Colorectal Mutant Cancer Protein, Protein MCC, Mutated In Colorectal Cancers, MCC1, FLJ38893, FLJ46755, DKFZp762O1615) (AP) discontinued
129480-AP 100 µL

MCC (Colorectal Mutant Cancer Protein, Protein MCC, Mutated In Colorectal Cancers, MCC1, FLJ38893, FLJ46755, DKFZp762O1615) (AP) discontinued

Sign In for Pricing
View Details
Adrenergic Receptor Beta 3 (ADRB3) Antibody
abx301047-01 20 µg

Adrenergic Receptor Beta 3 (ADRB3) Antibody

Sign In for Pricing
View Details
Adrenergic Receptor Beta 3 (ADRB3) Antibody
abx301047-02 50 µg

Adrenergic Receptor Beta 3 (ADRB3) Antibody

Sign In for Pricing
View Details
Adrenergic Receptor Beta 3 (ADRB3) Antibody
abx301047-03 100 µg

Adrenergic Receptor Beta 3 (ADRB3) Antibody

Sign In for Pricing
View Details
Adrenergic Receptor Beta 3 (ADRB3) Antibody
abx301047-04 200 µg

Adrenergic Receptor Beta 3 (ADRB3) Antibody

Sign In for Pricing
View Details