Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTPRZ1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Protein tyrosine phosphatase receptor type Z1

Gene Aliases

HPTPZ; HPTPzeta; phosphacan; protein tyrosine phosphatase, receptor-type, Z polypeptide 1; protein tyrosine phosphatase, receptor-type, zeta polypeptide 1; Protein-tyrosine phosphatase receptor type Z polypeptide 1; protein-tyrosine phosphatase receptor type Z polypeptide 2; PTP18; PTPRZ; PTPZ; PTP-ZETA; receptor-type tyrosine phosphatase beta/zeta; receptor-type tyrosine-protein phosphatase zeta; RPTPB; RPTPbeta; R-PTP-zeta-2.

Gene ID

5803

Accession Number

NP_001193767.1

Reactivity

Homo sapiens|Human

Target

Protein tyrosine phosphatase that negatively regulates oligodendrocyte precursor proliferation in the embryonic spinal cord. Required for normal differentiation of the precursor cells into mature, fully myelinating oligodendrocytes. May play a role in protecting oligondendrocytes against apoptosis. May play a role in the establishment of contextual memory, probably via the dephosphorylation of proteins that are part of important signaling cascades (By similarity) .

Type

Protein

Source

Yeast

Sequence

IGWSYTGALNQKNWGKKYPTCNSPKQSPINIDEDLTQVNVNLKKLKFQGWDKTSLENTFIHNTGKTVEINLTNDYRVSGGVSEMVFKASKITFHWGKCNMSSDGSEHSLEGQKFPLEMQIYCFDADRFSSFEEAVKGKGKLRALSILFEVGTEENLDFKAIIDGVESVSRFGKQAALDPFILLNLLPNSTDKYYIYNGSLTSPPCTDTVDWIVFKDTVSISESQLAVFCEVLTMQQSGYVMLMDYLQNNFREQQYKFSRQVFSSY

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

32.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PTPRZ1

Host or Source

Human

Protein Name

Receptor-type tyrosine-protein phosphatase zeta

Gene Name URL

PTPRZ1

Nucleotide Accession Number

NM_001206838.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

β2C Tubulin CRISPR Activation Plasmid (h)
sc-400056-ACT 20 µg

β2C Tubulin CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Lithium 2- (1,3,4-oxadiazol-2-yl) acetate
JFC42846-01 50 mg

Lithium 2- (1,3,4-oxadiazol-2-yl) acetate

Sign In for Pricing
View Details
Lithium 2- (1,3,4-oxadiazol-2-yl) acetate
JFC42846-02 0.5 g

Lithium 2- (1,3,4-oxadiazol-2-yl) acetate

Sign In for Pricing
View Details
LOC100130933 Lentiviral Activation Particles (h)
sc-418794-LAC 200 µL

LOC100130933 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Rat Rap1gap2 Pre-designed siRNA Set A
SI211609A 1 Each

Rat Rap1gap2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
vvhA Antibody, FITC conjugated
A50512-50UL 50 μL

vvhA Antibody, FITC conjugated

Sign In for Pricing
View Details