Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTPRB Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Protein tyrosine phosphatase receptor type B

Gene Aliases

HPTPB; HPTP-BETA; protein tyrosine phosphatase, receptor type, beta polypeptide; PTPB; receptor-type tyrosine-protein phosphatase beta; R-PTP-BETA; vascular endothelial protein tyrosine phosphatase; VEPTP; VE-PTP.

Gene ID

5787

Reactivity

Homo sapiens|Human

Target

Plays an important role in blood vessel remodeling and angiogenesis. Not necessary for the initial formation of blood vessels, but is essential for their maintenance and remodeling. Can induce dephosphorylation of TEK/TIE2, CDH5/VE-cadherin and KDR/VEGFR-2. Regulates angiopoietin-TIE2 signaling in endothelial cells. Acts as a negative regulator of TIE2, and controls TIE2 driven endothelial cell proliferation, which in turn affects blood vessel remodeling during embryonic development and determines blood vessel size during perinatal growth. Essential for the maintenance of endothelial cell contact integrity and for the adhesive function of VE-cadherin in endothelial cells and this requires the presence of plakoglobin (By similarity) .

Type

Protein

Source

Yeast

Sequence

RQKVSHGRERPSARLSIRRDRPLSVHLNLGQKGNRKTSCPIKINQFEGHFMKLQADSNYLLSKEYEELKDVGRNQSCDIALLPENRGKNRYNNILPYDATRVKLSNVDDDPCSDYINASYIPGNNFRREYIVTQGPLPGTKDDFWKMVWEQNVHNIVMVTQCVEKGRVKCDHYWPADQDSLYYGDLILQMLSESVLPEWTIREFKICGEEQLDAHRLIRHFHYTVWPDHGVPETTQSLIQFVRTVRDYINRSPGAGPTVVHCSAGVGRTGTFIALDRILQQLDSKDSVDIYGAVHDLRLHRVHMVQTECQYVYLHQCVRDVLRARKLRSEQENPLFPIYENVNPEYHRDPVYSRH

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

43.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PTPRB

Host or Source

Human

Protein Name

Receptor-type tyrosine-protein phosphatase beta

Gene Name URL

PTPRB

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal CPOX Antibody
NBP2-92779-0.02mL 0.02 mL

Rabbit Polyclonal CPOX Antibody

Sign In for Pricing
View Details
EDDP BGG Conjugate
MBS319729-01 1 mg

EDDP BGG Conjugate

Sign In for Pricing
View Details
EDDP BGG Conjugate
MBS319729-02 5x 1 mg

EDDP BGG Conjugate

Sign In for Pricing
View Details
POFUT2, ID (POFUT2, C21orf80, FUT13, KIAA0958, GDP-fucose protein O-fucosyltransferase 2, Peptide-O-fucosyltransferase 2) (Azide free) (HRP) discontinued
040238-HRP 200 µL

POFUT2, ID (POFUT2, C21orf80, FUT13, KIAA0958, GDP-fucose protein O-fucosyltransferase 2, Peptide-O-fucosyltransferase 2) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Dynorphin A (1-12), porcine
orb2694778-01 5 mg

Dynorphin A (1-12), porcine

Sign In for Pricing
View Details
Dynorphin A (1-12), porcine
orb2694778-02 10 mg

Dynorphin A (1-12), porcine

Sign In for Pricing
View Details