Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P26678ÀšÃ‚ Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Phospholamban

Gene Aliases

Cardiac phospholamban; CMD1P; CMH18; PLB.

Gene ID

5350

Reactivity

Homo sapiens|Human

Target

Reversibly inhibits the activity of ATP2A2 in cardiac sarcoplasmic reticulum by decreasing the apparent affinity of the ATPase for Ca (2+) . Modulates the contractility of the heart muscle in response to physiological stimuli via its effects on ATP2A2. Modulates calcium re-uptake during muscle relaxation and plays an important role in calcium homeostasis in the heart muscle. The degree of ATP2A2 inhibition depends on the oligomeric state of PLN. ATP2A2 inhibition is alleviated by PLN phosphorylation.

Type

Protein

Source

Yeast

Sequence

MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

33.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PLN

Host or Source

Human

Protein Name

Cardiac phospholamban

Gene Name URL

PLN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Acbd5 siRNA Oligos set (Rat)
11155176 3x 5 nmol

Acbd5 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
Recombinant Human Arachidonate 12-lipoxygenase, 12R-type (ALOX12B)
MBS1199675-01 0.02 mg (E-Coli)

Recombinant Human Arachidonate 12-lipoxygenase, 12R-type (ALOX12B)

Sign In for Pricing
View Details
Recombinant Human Arachidonate 12-lipoxygenase, 12R-type (ALOX12B)
MBS1199675-02 0.02 mg (Yeast)

Recombinant Human Arachidonate 12-lipoxygenase, 12R-type (ALOX12B)

Sign In for Pricing
View Details
Recombinant Human Arachidonate 12-lipoxygenase, 12R-type (ALOX12B)
MBS1199675-03 0.1 mg (E-Coli)

Recombinant Human Arachidonate 12-lipoxygenase, 12R-type (ALOX12B)

Sign In for Pricing
View Details
Recombinant Human Arachidonate 12-lipoxygenase, 12R-type (ALOX12B)
MBS1199675-04 0.1 mg (Yeast)

Recombinant Human Arachidonate 12-lipoxygenase, 12R-type (ALOX12B)

Sign In for Pricing
View Details
Recombinant Human Arachidonate 12-lipoxygenase, 12R-type (ALOX12B)
MBS1199675-05 0.02 mg (Baculovirus)

Recombinant Human Arachidonate 12-lipoxygenase, 12R-type (ALOX12B)

Sign In for Pricing
View Details