Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PI3 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Peptidase inhibitor 3

Gene Aliases

Cementoin; elafin; elastase-specific inhibitor; ESI; Peptidase inhibitor 3; peptidase inhibitor 3, skin-derived; PI-3; pre-elafin; protease inhibitor 3, skin-derived (SKALP) ; protease inhibitor WAP3; SKALP; skin-derived antileukoproteinase; trappin-2; WAP four-disulfide core domain 14; WAP four-disulfide core domain protein 14; WAP3; WFDC14.

Gene ID

5266

Accession Number

NP_002629.1

Reactivity

Homo sapiens|Human

Target

Neutrophil and pancreatic elastase-specific inhibitor of skin. It may prevent elastase-mediated tissue proteolysis.

Type

Protein

Source

Yeast

Sequence

AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PI3

Host or Source

Human

Protein Name

Elafin

Gene Name URL

PI3

Nucleotide Accession Number

NM_002638.3

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human ITGB2 shRNA (UAS) - Lentiviral human ITGB2 shRNA (UAS) (25)
GTR15289373 1 Vial

Lentiviral human ITGB2 shRNA (UAS) - Lentiviral human ITGB2 shRNA (UAS) (25)

Sign In for Pricing
View Details
Mouse Soluble Cluster of Differentiation 146 (sCD146) ELISA Kit
abx254402-01 96 Tests

Mouse Soluble Cluster of Differentiation 146 (sCD146) ELISA Kit

Sign In for Pricing
View Details
Mouse Soluble Cluster of Differentiation 146 (sCD146) ELISA Kit
abx254402-02 5x 96 Tests

Mouse Soluble Cluster of Differentiation 146 (sCD146) ELISA Kit

Sign In for Pricing
View Details
Mouse Soluble Cluster of Differentiation 146 (sCD146) ELISA Kit
abx254402-03 10x 96 Tests

Mouse Soluble Cluster of Differentiation 146 (sCD146) ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Hoxa11 shRNA (UAS) - Lentiviral mouse Hoxa11 shRNA (UAS, iRFP) plasmid
GTR15199912 1 Vial

Lentiviral mouse Hoxa11 shRNA (UAS) - Lentiviral mouse Hoxa11 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
NUDT16L1, aa1-211, Recombinant, Human (Nudix (Nucleoside Diphosphate Linked Moiety X)-type Motif 16-like 1, NUDT16-like Protein 1, MGC11275, Protein Syndesmos, SDOS)
MBS636859-01 0.1 mg

NUDT16L1, aa1-211, Recombinant, Human (Nudix (Nucleoside Diphosphate Linked Moiety X)-type Motif 16-like 1, NUDT16-like Protein 1, MGC11275, Protein Syndesmos, SDOS)

Sign In for Pricing
View Details