Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MS4A1 Recombinant Protein (Mouse)

Product Specifications

CAS Number

9000-83-3

Gene Name

Membrane-spanning 4-domains, subfamily A, member 1

Gene Aliases

AA960661; B-cell differentiation antigen Ly-44; B-lymphocyte antigen CD20; Cd20; CD20 antigen; Ly-4; Ly-44; lymphocyte antigen 44; Membrane-spanning 4-domains subfamily A member 1; membrane-spanning 4-domains, subfamily A, member 2; Ms4a2.

Gene ID

12482

Accession Number

NP_031667.1

Reactivity

Mouse|Mus musculus

Target

This protein may be involved in the regulation of B-cell activation and proliferation.

Type

Protein

Source

Yeast

Sequence

ILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVFLGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

20.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Ms4a1

Host or Source

Mouse

Protein Name

B-lymphocyte antigen CD20

Gene Name URL

Ms4a1

Nucleotide Accession Number

NM_007641.5

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF81 (Zinc Finger Protein 81, dJ54B20.6, HFZ20, MRX45) (MaxLight 405)
MBS6193563-01 0.1 mL

ZNF81 (Zinc Finger Protein 81, dJ54B20.6, HFZ20, MRX45) (MaxLight 405)

Sign In for Pricing
View Details
ZNF81 (Zinc Finger Protein 81, dJ54B20.6, HFZ20, MRX45) (MaxLight 405)
MBS6193563-02 5x 0.1 mL

ZNF81 (Zinc Finger Protein 81, dJ54B20.6, HFZ20, MRX45) (MaxLight 405)

Sign In for Pricing
View Details
Anti-p40-DeltaNp63 Mouse mAb
GB122169-100 100 μL

Anti-p40-DeltaNp63 Mouse mAb

Sign In for Pricing
View Details
Rabbit Polyclonal ATPase Antibody [DyLight 594]
NBP2-98188DL594 0.1 mL

Rabbit Polyclonal ATPase Antibody [DyLight 594]

Sign In for Pricing
View Details
TGF-beta 1 Biotinylated Affinity Purified PAb
BAF240 50 µg

TGF-beta 1 Biotinylated Affinity Purified PAb

Sign In for Pricing
View Details
Interleukin 18BP (Interleukin 18 Binding Protein, IL-18BP, IL18BP, IL18BPa, Tadekinig-alfa, Interleukin-18-binding Protein) (MaxLight 650)
128539-ML650 100 µL

Interleukin 18BP (Interleukin 18 Binding Protein, IL-18BP, IL18BP, IL18BPa, Tadekinig-alfa, Interleukin-18-binding Protein) (MaxLight 650)

Sign In for Pricing
View Details