Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFI6 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Interferon alpha inducible protein 6

Gene Aliases

6-16; FAM14C; G1P3; IFI616; IFI-6-16; interferon alpha-inducible protein 6; interferon, alpha-inducible protein clone IFI-6-16; interferon-induced protein 6-16.

Gene ID

2537

Accession Number

NP_002029.3

Reactivity

Homo sapiens|Human

Target

This gene was first identified as one of the many genes induced by interferon. The encoded protein may play a critical role in the regulation of apoptosis. A minisatellite that consists of 26 repeats of a 12 nucleotide repeating element resembling the mammalian splice donor consensus sequence begins near the end of the second exon. Alternatively spliced transcript variants that encode different isoforms by using the two downstream repeat units as splice donor sites have been described.

Type

Protein

Source

Yeast

Sequence

GKKKCSESSDSGSGFWKALTFMAVGGGLAVAGLPALGFTGAGIAANSVAASLMSWSAILNGGGVPAGGLVATLQSLGAGGSSVVIGNIGALMGYATHKYLDSEEDEE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

12.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

IFI6

Host or Source

Human

Protein Name

Interferon alpha-inducible protein 6

Gene Name URL

IFI6

Nucleotide Accession Number

NM_002038.3

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hepatitis B Core Antigen (HBcAg)
H1905-20-01 100 µg

Hepatitis B Core Antigen (HBcAg)

Sign In for Pricing
View Details
Hepatitis B Core Antigen (HBcAg)
H1905-20-02 1 mg

Hepatitis B Core Antigen (HBcAg)

Sign In for Pricing
View Details
Kaptin Lentiviral Activation Particles (h2)
sc-411571-LAC-2 200 µL

Kaptin Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
NALP4, Control Peptide (NACHT-, LRR-and PYD-containing Protein 4, NACHT Leucine Rich Repeat and PYD Containing 4, CLR19.5, FLJ32126, Nucleotide Binding Oligomerization Domain Leucine Rich Repeat and Pyrin Domain Containing 4, NLR Family Pyrin Domain Containing 4, NLRP4, PAAD and NACHT Containing Protein 2, PAN2, PYRIN Containing APAF1-like Protein 4, PYPAF4, Ribonuclease Inhibitor 2, RNH2)
149492 50 µg

NALP4, Control Peptide (NACHT-, LRR-and PYD-containing Protein 4, NACHT Leucine Rich Repeat and PYD Containing 4, CLR19.5, FLJ32126, Nucleotide Binding Oligomerization Domain Leucine Rich Repeat and Pyrin Domain Containing 4, NLR Family Pyrin Domain Containing 4, NLRP4, PAAD and NACHT Containing Protein 2, PAN2, PYRIN Containing APAF1-like Protein 4, PYPAF4, Ribonuclease Inhibitor 2, RNH2)

Sign In for Pricing
View Details
CARHSP1 siRNA (Human)
CRH8380-01 15 nmol

CARHSP1 siRNA (Human)

Sign In for Pricing
View Details
CARHSP1 siRNA (Human)
CRH8380-02 30 nmol

CARHSP1 siRNA (Human)

Sign In for Pricing
View Details