Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HNRNPL Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Heterogeneous nuclear ribonucleoprotein L

Gene Aliases

Epididymis secretory sperm binding protein; heterogeneous nuclear ribonucleoprotein L; hnRNP L; hnRNP-L; HNRPL; P/OKcl.14.

Gene ID

3191

Accession Number

NP_001005335.1

Reactivity

Homo sapiens|Human

Target

Heterogeneous nuclear RNAs (hnRNAs) which include mRNA precursors and mature mRNAs are associated with specific proteins to form heterogenous ribonucleoprotein (hnRNP) complexes. Heterogeneous nuclear ribonucleoprotein L is among the proteins that are stably associated with hnRNP complexes and along with other hnRNP proteins is likely to play a major role in the formation, packaging, processing, and function of mRNA. Heterogeneous nuclear ribonucleoprotein L is present in the nucleoplasm as part of the HNRP complex. HNRP proteins have also been identified outside of the nucleoplasm. Exchange of hnRNP for mRNA-binding proteins accompanies transport of mRNA from the nucleus to the cytoplasm. Since HNRP proteins have been shown to shuttle between the nucleus and the cytoplasm, it is possible that they also have cytoplasmic functions. Two transcript variants encoding different isoforms have been found for this gene.

Type

Protein

Source

Yeast

Sequence

IRGLIDGVVEADLVEALQEFGPISYVVVMPKKRQALVEFEDVLGACNAVNYAADNQIYIAGHPAFVNYSTSQKISRPGDSDDSRSVNSVLLFTILNPIYSITTDVLYTICNPCGPVQRIVIFRKNGVQAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYTNPNLSGQGDPGSNPNKRQRQPPLLGDHPAEYGGPHGGYHSHYHDEGYGPPPPHYEGRRMGPPVGGH

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

29 kDa

Protein Length

Recombinant

NCBI Gene Symbol

HNRNPL

Host or Source

Human

Protein Name

HNRNPL protein

Gene Name URL

HNRNPL

Nucleotide Accession Number

NM_001005335.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Armadillo repeat containing protein 2 ELISA Kit
MBS7211495-01 48 Well

Human Armadillo repeat containing protein 2 ELISA Kit

Sign In for Pricing
View Details
Human Armadillo repeat containing protein 2 ELISA Kit
MBS7211495-02 96 Well

Human Armadillo repeat containing protein 2 ELISA Kit

Sign In for Pricing
View Details
Human Armadillo repeat containing protein 2 ELISA Kit
MBS7211495-03 5x 96 Well

Human Armadillo repeat containing protein 2 ELISA Kit

Sign In for Pricing
View Details
Human Armadillo repeat containing protein 2 ELISA Kit
MBS7211495-04 10x 96 Well

Human Armadillo repeat containing protein 2 ELISA Kit

Sign In for Pricing
View Details
SFRP4 (NM_003014) Human Tagged ORF Clone
RG205365 10 µg

SFRP4 (NM_003014) Human Tagged ORF Clone

Sign In for Pricing
View Details
Lentiviral mouse Nin shRNA (UAS) - Lentiviral mouse Nin shRNA (UAS, iRFP) plasmid
GTR15236308 1 Vial

Lentiviral mouse Nin shRNA (UAS) - Lentiviral mouse Nin shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details