Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hmox1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Heme oxygenase 1

Gene Aliases

D8Wsu38; D8Wsu38e; heme oxygenase (decycling) 1; heme oxygenase 1; Hemox; hemoxygenase; Hmo; Hmox; HO; HO-; HO1; HO-1; Hsp; Hsp32; P32 protein.

Gene ID

15368

Accession Number

NP_034572.1

Reactivity

Mouse|Mus musculus

Target

Heme oxygenase cleaves the heme ring at the alpha methene bridge to form biliverdin. Biliverdin is subsequently converted to bilirubin by biliverdin reductase. Under physiological conditions, the activity of heme oxygenase is highest in the spleen, where senescent erythrocytes are sequestrated and destroyed. Exhibits cytoprotective effects since excess of free heme sensitizes cells to undergo apoptosis.

Type

Protein

Source

Yeast

Sequence

MERPQPDSMPQDLSEALKEATKEVHIQAENAEFMKNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEIIPCTPATQHYVKRLHEVGRTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPNIDSPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQVMLTEEHKDQSPSQMASLRQRPASLVQDTAPAETPRGKPQISTSSSQTPLLQWVLTLSFLLATVAVGIYAM

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

34.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Hmox1

Host or Source

Mouse

Protein Name

Heme oxygenase 1

Gene Name URL

Hmox1

Nucleotide Accession Number

NM_010442.2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colloidal Gold Conjugated Monoclonal Antibody to Respiratory Syncytial Virus,  15nm
GM-46-15 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Respiratory Syncytial Virus, 15nm

Sign In for Pricing
View Details
iFluor™ 594 Conjugated NeuN Recombinant Rabbit Monoclonal Antibody [SR45-07]
HA720167F 100 µL

iFluor™ 594 Conjugated NeuN Recombinant Rabbit Monoclonal Antibody [SR45-07]

Sign In for Pricing
View Details
1-(2-Naphthyl) 2-Trifluroacetamido-3,4,6-tri-O-acetyl-2-deoxy-Beta-D-glucopyranoside-d7
TRC-N344009-2.5MG 2.5 mg

1-(2-Naphthyl) 2-Trifluroacetamido-3,4,6-tri-O-acetyl-2-deoxy-Beta-D-glucopyranoside-d7

Sign In for Pricing
View Details
MMP25 (C-term) Rabbit Polyclonal Antibody
AP13179PU-N 400 µL

MMP25 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human USP39 activation kit by CRISPRa
GA107338 1 Kit

Human USP39 activation kit by CRISPRa

Sign In for Pricing
View Details
MEK7 (MAP2K7) Rabbit Polyclonal Antibody
AP21117PU-N 100 µg

MEK7 (MAP2K7) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details