Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gcgr Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Glucagon receptor

Gene Aliases

G; GL-R; glucagon receptor; GR.

Gene ID

14527

Accession Number

NP_032127.2

Reactivity

Mouse|Mus musculus

Target

G-protein coupled receptor for glucagon that plays a central role in the regulation of blood glucose levels and glucose homeostasis. Regulates the rate of hepatic glucose production by promoting glycogen hydrolysis and gluconeogenesis. Plays an important role in mediating the responses to fasting. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Promotes activation of adenylate cyclase. Besides, plays a role in signaling via a phosphatidylinositol-calcium second messenger system.

Type

Protein

Source

Yeast

Sequence

AQVMDFLFEKWKLYSDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPPNTTANISCPWYLPWYHKVQHRLVFKRCGPDGQWVRGPRGQPWRNASQCQLDDEEIEVQKGVAKMYSSQQ

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

15.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Gcgr

Host or Source

Mouse

Protein Name

Glucagon receptor

Gene Name URL

Gcgr

Nucleotide Accession Number

NM_008101.2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IKK alpha/beta Recombinant Rabbit Monoclonal Antibody
orb2561347-01 25 µL

IKK alpha/beta Recombinant Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
IKK alpha/beta Recombinant Rabbit Monoclonal Antibody
orb2561347-02 50 µL

IKK alpha/beta Recombinant Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
IKK alpha/beta Recombinant Rabbit Monoclonal Antibody
orb2561347-03 100 µL

IKK alpha/beta Recombinant Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
MCT12 CRISPR Activation Plasmid (m2)
sc-433777-ACT-2 20 µg

MCT12 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
[1- (3-Phenyl-1,2,4-oxadiazol-5-yl) cyclohexyl]amine
sc-495325 500 mg

[1- (3-Phenyl-1,2,4-oxadiazol-5-yl) cyclohexyl]amine

Sign In for Pricing
View Details
CDK3 Polyclonal Antibody
BT-AP14872-01 20 µL

CDK3 Polyclonal Antibody

Sign In for Pricing
View Details