Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fxn Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Frataxin

Gene Aliases

FA; FARR; Fr; frataxin, mitochondrial; Frda; Friedreich ataxia; X25.

Gene ID

14297

Accession Number

NP_032070.1

Reactivity

Mouse|Mus musculus

Target

Promotes the biosynthesis of heme and assembly and repair of iron-sulfur clusters by delivering Fe (2+) to proteins involved in these pathways. May play a role in the protection against iron-catalyzed oxidative stress through its ability to catalyze the oxidation of Fe (2+) to Fe (3+) ; the oligomeric form but not the monomeric form has in vitro ferroxidase activity. May be able to store large amounts of iron in the form of a ferrihydrite mineral by oligomerization. Modulates the RNA-binding activity of ACO1 (By similarity) .

Type

Protein

Source

Yeast

Sequence

LGTLDNPSSLDETAYERLAEETLDSLAEFFEDLADKPYTLEDYDVSFGDGVLTIKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLARELTKALNTKLDLSSLAYSGKGT

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

16.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Fxn

Host or Source

Mouse

Protein Name

Frataxin, mitochondrial

Gene Name URL

Fxn

Nucleotide Accession Number

NM_008044.2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CXCR6 Blocking Peptide
NBP1-76871PEP 0.05 mg

CXCR6 Blocking Peptide

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD83 Antibody [HB15e]
MBS2568278-01 20 Tests

PE/Cyanine7 Anti-Human CD83 Antibody [HB15e]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD83 Antibody [HB15e]
MBS2568278-02 100 Tests

PE/Cyanine7 Anti-Human CD83 Antibody [HB15e]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD83 Antibody [HB15e]
MBS2568278-03 2x 100 Tests

PE/Cyanine7 Anti-Human CD83 Antibody [HB15e]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD83 Antibody [HB15e]
MBS2568278-04 10x 100 Tests

PE/Cyanine7 Anti-Human CD83 Antibody [HB15e]

Sign In for Pricing
View Details
Lentiviral human CDK20 sgRNA gene knockout kit - Lentiviral human CDK20 sgRNA gene knockout kit (100)
GTR15381985 1 Vial

Lentiviral human CDK20 sgRNA gene knockout kit - Lentiviral human CDK20 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details