What is the catalog number for FCGRT Recombinant Protein?

The catalog number for FCGRT Recombinant Protein is OPCA02658-20UG.

What sizes are available for FCGRT Recombinant Protein?

FCGRT Recombinant Protein is available in the following size(s): 20 µg.

Is FCGRT Recombinant Protein in stock?

FCGRT Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

What should I do if I need to report a performance issue with a specific lot of this product?

Provide the catalogue number, product name, lot number, and your experimental results to our technical support team. They’ll investigate and, if needed, escalate to the manufacturer, provided the product was used before expiry and stored correctly.

What is the isotype of this antibody?

Isotype information such as IgG1 or IgG2a is listed in the product specifications on the datasheet, relevant for selecting compatible detection reagents.

Can I get a trial-size or discounted first order of this product?

We don’t generally offer free samples, but trial discounts in exchange for feedback and validation results are almost always possible. Contact us with your intended application to arrange one.

FCGRT Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Fc fragment of IgG receptor and transporter

Gene Aliases

Alpha-chain; Fc fragment of IgG, receptor, transporter, alpha; FCRN; FcRn alpha chain; heavy chain of the major histocompatibility complex class I-like Fc receptor; IgG Fc fragment receptor transporter alpha chain; IgG receptor FcRn large subunit p51; immunoglobulin receptor, intestinal, heavy chain; major histocompatibility complex class I-like Fc receptor; neonatal Fc receptor; neonatal Fc-receptor for Ig; transmembrane alpha chain of the neonatal receptor.

Gene ID

2217

Accession Number

NP_001129491.1

Reactivity

Homo sapiens|Human

Target

Binds to the Fc region of monomeric immunoglobulins gamma (PubMed:7964511, PubMed:10933786) . Mediates the selective uptake of IgG from milk and helps newborn animals to acquire passive immunity. IgG in the milk is bound at the apical surface of the intestinal epithelium. The resultant FcRn-IgG complexes are transcytosed across the intestinal epithelium and IgG is released from FcRn into blood or tissue fluids (By similarity) . Possible role in transfer of immunoglobulin G from mother to fetus (PubMed:7964511) .

Type

Protein

Source

Yeast

Sequence

AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.