Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF4EBP2 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Eukaryotic translation initiation factor 4E binding protein 2

Gene Aliases

4EBP2;4E-BP2; eIF4E-binding protein 2; eukaryotic translation initiation factor 4E-binding protein 2; PHASII; phosphorylated, heat and acid stable regulated by insulin protein II.

Gene ID

1979

Accession Number

NP_004087.1

Reactivity

Homo sapiens|Human

Target

Repressor of translation initiation involved in synaptic plasticity, learning and memory formation (By similarity) . Regulates EIF4E activity by preventing its assembly into the eIF4F complex: hypophosphorylated form of EIF4EBP2 competes with EIF4G1/EIF4G3 and strongly binds to EIF4E, leading to repress translation. In contrast, hyperphosphorylated form dissociates from EIF4E, allowing interaction between EIF4G1/EIF4G3 and EIF4E, leading to initiation of translation (PubMed:25533957) . EIF4EBP2 is enriched in brain and acts as a regulator of synapse activity and neuronal stem cell renewal via its ability to repress translation initiation (By similarity) . Mediates the regulation of protein translation by hormones, growth factors and other stimuli that signal through the MAP kinase and mTORC1 pathways (By similarity) .

Type

Protein

Source

Yeast

Sequence

MSSSAGSGHQPSQSRAIPTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDRRNSPMAQTPPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

14.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

EIF4EBP2

Host or Source

Human

Protein Name

Eukaryotic translation initiation factor 4E-binding protein 2

Gene Name URL

EIF4EBP2

Nucleotide Accession Number

NM_004096.4

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPP1CC discontinued
513042 100 µg

PPP1CC discontinued

Sign In for Pricing
View Details
Nunc Immuno-Module C8 Starwell MaxiSorp
441653 60 / PCK

Nunc Immuno-Module C8 Starwell MaxiSorp

Sign In for Pricing
View Details
ASH2 Antibody
3772-100 100 µL

ASH2 Antibody

Sign In for Pricing
View Details
Recombinant Human CASP2 Protein, N-GST & C-His
orb3152448-01 50 µg

Recombinant Human CASP2 Protein, N-GST & C-His

Sign In for Pricing
View Details
Recombinant Human CASP2 Protein, N-GST & C-His
orb3152448-02 100 µg

Recombinant Human CASP2 Protein, N-GST & C-His

Sign In for Pricing
View Details
Recombinant Human CASP2 Protein, N-GST & C-His
orb3152448-03 1 mg

Recombinant Human CASP2 Protein, N-GST & C-His

Sign In for Pricing
View Details