Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTSK Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Cathepsin K

Gene Aliases

Cathepsin K; cathepsin O; cathepsin O1; cathepsin O2; cathepsin X; CTS02; CTSO; CTSO1; CTSO2; PKND; PYCD.

Gene ID

1513

Accession Number

NP_000387.1

Reactivity

Homo sapiens|Human

Target

Closely involved in osteoclastic bone resorption and may participate partially in the disorder of bone remodeling. Displays potent endoprotease activity against fibrinogen at acid pH. May play an important role in extracellular matrix degradation.

Type

Protein

Source

Yeast

Sequence

APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

25.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CTSK

Host or Source

Human

Protein Name

Cathepsin K

Gene Name URL

CTSK

Nucleotide Accession Number

NM_000396.3

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pip Rat siRNA Oligo Duplex (Locus ID 64673)
SR513094 1 Kit

Pip Rat siRNA Oligo Duplex (Locus ID 64673)

Sign In for Pricing
View Details
KIRAVIA Blue 520™ anti-human CD141 (Thrombomodulin)
GT11987 25 Tests

KIRAVIA Blue 520™ anti-human CD141 (Thrombomodulin)

Sign In for Pricing
View Details
MPP3, CT (MPP3, DLG3, MAGUK p55 subfamily member 3, Discs large homolog 3, Protein MPP3) (MaxLight 750)
MBS6321942-01 0.1 mL

MPP3, CT (MPP3, DLG3, MAGUK p55 subfamily member 3, Discs large homolog 3, Protein MPP3) (MaxLight 750)

Sign In for Pricing
View Details
MPP3, CT (MPP3, DLG3, MAGUK p55 subfamily member 3, Discs large homolog 3, Protein MPP3) (MaxLight 750)
MBS6321942-02 5x 0.1 mL

MPP3, CT (MPP3, DLG3, MAGUK p55 subfamily member 3, Discs large homolog 3, Protein MPP3) (MaxLight 750)

Sign In for Pricing
View Details
RPP25 Protein Vector (Rat) (pPM-C-HA)
PV302352 500 ng

RPP25 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Mouse anti Human IgG2 (Fab subclass specific)
MAHu/IgG2/MAb 0.2 mg

Mouse anti Human IgG2 (Fab subclass specific)

Sign In for Pricing
View Details