Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNKSR2 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Connector enhancer of kinase suppressor of Ras 2

Gene Aliases

CNK homolog protein 2; CNK2; connector enhancer of kinase suppressor of ras 2; connector enhancer of KSR2; KSR2; MAGUIN; membrane-associated guanylate kinase-interacting protein; MRXSHG.

Gene ID

22866

Accession Number

NP_001162118.1

Reactivity

Homo sapiens|Human

Target

May function as an adapter protein or regulator of Ras signaling pathways.

Type

Protein

Source

Yeast

Sequence

AAEHLDDMNRWLNRINMLTAGYAERERIKQEQDYWSESDKEEADTPSTPKQDSPPPPYDTYPRPPSMSCASPYVEAKHSRLSSTETSQSQSSHEEFRQEVTGSSAVSPIRKTASQRRSWQDLIETPLTSSGLHYLQTLPLEDSVFSDSAAI

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

19.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CNKSR2

Host or Source

Human

Protein Name

Connector enhancer of kinase suppressor of ras 2

Gene Name URL

CNKSR2

Nucleotide Accession Number

NM_001168647.1

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Serine/Threonine-Protein Phosphatase PP1-Gamma Catalytic Subunit (PPP1CC) ELISA Kit
MBS9931699-01 48 Well

Rat Serine/Threonine-Protein Phosphatase PP1-Gamma Catalytic Subunit (PPP1CC) ELISA Kit

Sign In for Pricing
View Details
Rat Serine/Threonine-Protein Phosphatase PP1-Gamma Catalytic Subunit (PPP1CC) ELISA Kit
MBS9931699-02 96 Well

Rat Serine/Threonine-Protein Phosphatase PP1-Gamma Catalytic Subunit (PPP1CC) ELISA Kit

Sign In for Pricing
View Details
Rat Serine/Threonine-Protein Phosphatase PP1-Gamma Catalytic Subunit (PPP1CC) ELISA Kit
MBS9931699-03 5x 96 Well

Rat Serine/Threonine-Protein Phosphatase PP1-Gamma Catalytic Subunit (PPP1CC) ELISA Kit

Sign In for Pricing
View Details
Rat Serine/Threonine-Protein Phosphatase PP1-Gamma Catalytic Subunit (PPP1CC) ELISA Kit
MBS9931699-04 10x 96 Well

Rat Serine/Threonine-Protein Phosphatase PP1-Gamma Catalytic Subunit (PPP1CC) ELISA Kit

Sign In for Pricing
View Details
KCC2, Rat, Control Peptide (K, Cl Cotransporter 2)
K0120 100 µg

KCC2, Rat, Control Peptide (K, Cl Cotransporter 2)

Sign In for Pricing
View Details
Human Fatty Acid Binding Protein 1, Liver (FABP1) CLIA Kit
abx492871-01 96 Tests

Human Fatty Acid Binding Protein 1, Liver (FABP1) CLIA Kit

Sign In for Pricing
View Details