Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C1qa Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Complement component 1, q subcomponent, alpha polypeptide

Gene Aliases

Adic; adiponectin c; AI255395; C1q; complement C1q subcomponent subunit A.

Gene ID

12259

Accession Number

NP_031598.2

Reactivity

Mouse|Mus musculus

Target

C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca (2+) -dependent C1r (2) C1s (2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.

Type

Protein

Source

Yeast

Sequence

EDVCRAPNGKDGAPGNPGRPGRPGLKGERGEPGAAGIRTGIRGFKGDPGESGPPGKPGNVGLPGPSGPLGDSGPQGLKGVKGNPGNIRDQPRPAFSAIRQNPMTLGNVVIFDKVLTNQESPYQNHTGRFICAVPGFYYFNFQVISKWDLCLFIKSSSGGQPRDSLSFSNTNNKGLFQVLAGGTVLQLRRGDEVWIEKDPAKGRIYQGTEADSIFSGFLIFPSA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

25.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

C1qa

Host or Source

Mouse

Protein Name

Complement C1q subcomponent subunit A

Gene Name URL

C1qa

Nucleotide Accession Number

NM_007572.2

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Hoxd13 activation kit by CRISPRa
GA201969 1 Kit

Mouse Hoxd13 activation kit by CRISPRa

Sign In for Pricing
View Details
LIF Peptide
43-200P 0.1 mg

LIF Peptide

Sign In for Pricing
View Details
Transcription Factor GATA-6 (GATA6) Porcine ELISA Kit
H7263 96 Tests

Transcription Factor GATA-6 (GATA6) Porcine ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Ly96 shRNA (UAS) - Lentiviral mouse Ly96 shRNA (UAS, RFP) (25)
GTR15266735 1 Vial

Lentiviral mouse Ly96 shRNA (UAS) - Lentiviral mouse Ly96 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Human CTLA-4 Alexa Fluor 488 MAb (Clone 2188A)
FAB3252G-100UG 100 µg

Human CTLA-4 Alexa Fluor 488 MAb (Clone 2188A)

Sign In for Pricing
View Details
Fluorescent Particle Slide, Nile Red, 5.0-5.9 µm
FPS-5056 1 Slide

Fluorescent Particle Slide, Nile Red, 5.0-5.9 µm

Sign In for Pricing
View Details