Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C1qa Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Complement component 1, q subcomponent, alpha polypeptide

Gene Aliases

Adic; adiponectin c; AI255395; C1q; complement C1q subcomponent subunit A.

Gene ID

12259

Accession Number

NP_031598.2

Reactivity

Mouse|Mus musculus

Target

C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca (2+) -dependent C1r (2) C1s (2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.

Type

Protein

Source

Yeast

Sequence

EDVCRAPNGKDGAPGNPGRPGRPGLKGERGEPGAAGIRTGIRGFKGDPGESGPPGKPGNVGLPGPSGPLGDSGPQGLKGVKGNPGNIRDQPRPAFSAIRQNPMTLGNVVIFDKVLTNQESPYQNHTGRFICAVPGFYYFNFQVISKWDLCLFIKSSSGGQPRDSLSFSNTNNKGLFQVLAGGTVLQLRRGDEVWIEKDPAKGRIYQGTEADSIFSGFLIFPSA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

25.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

C1qa

Host or Source

Mouse

Protein Name

Complement C1q subcomponent subunit A

Gene Name URL

C1qa

Nucleotide Accession Number

NM_007572.2

More Discoveries

Explore Other Products

Browse additional items from our catalog

Efgartigimod Biosimilar - Research Grade
ICH5223-200mg 200 mg

Efgartigimod Biosimilar - Research Grade

Sign In for Pricing
View Details
Rat Tp53 Pre-designed siRNA Set B
SI215044B 1 Each

Rat Tp53 Pre-designed siRNA Set B

Sign In for Pricing
View Details
SLC39A4 Blocking Peptide
33R-7292 100 ug

SLC39A4 Blocking Peptide

Sign In for Pricing
View Details
20 Magnetic CryoVial add on
CV-20 20 Vials

20 Magnetic CryoVial add on

Sign In for Pricing
View Details
LTB4R2 Antibody - C-terminal region : FITC (ARP64275_P050-FITC)
ARP64275_P050-FITC 100 µL

LTB4R2 Antibody - C-terminal region : FITC (ARP64275_P050-FITC)

Sign In for Pricing
View Details
ITI-H4 (F-9) HRP
sc-515353 HRP 200 µg/mL

ITI-H4 (F-9) HRP

Sign In for Pricing
View Details