Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APEX1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Apurinic/apyrimidinic endodeoxyribonuclease 1

Gene Aliases

AP endonuclease class I; AP lyase; APE; APE1; APEN; APEX; APEX nuclease; APEX nuclease (multifunctional DNA repair enzyme) 1; apurinic/apyrimidinic (abasic) endonuclease; apurinic-apyrimidinic endonuclease 1; APX; deoxyribonuclease (apurinic or apyrimidinic) ; DNA- (apurinic or apyrimidinic site) endonuclease; DNA- (apurinic or apyrimidinic site) lyase; HAP1; protein REF-1; redox factor-1; REF1; REF-1.

Gene ID

328

Accession Number

NP_001231178.1

Reactivity

Homo sapiens|Human

Target

Multifunctional protein that plays a central role in the cellular response to oxidative stress. The two major activities of APEX1 in DNA repair and redox regulation of transcriptional factors. Functions as a apurinic/apyrimidinic (AP) endodeoxyribonuclease in the DNA base excision repair (BER) pathway of DNA lesions induced by oxidative and alkylating agents. Initiates repair of AP sites in DNA by catalyzing hydrolytic incision of the phosphodiester backbone immediately adjacent to the damage, generating a single-strand break with 5'-deoxyribose phosphate and 3'-hydroxyl ends. Does also incise at AP sites in the DNA strand of DNA/RNA hybrids, single-stranded DNA regions of R-loop structures, and single-stranded RNA molecules. Has a 3'-5' exoribonuclease activity on mismatched deoxyribonucleotides at the 3' termini of nicked or gapped DNA molecules during short-patch BER. Possesses a DNA 3' phosphodiesterase activity capable of removing lesions (such as phosphoglycolate) blocking the 3' side of DNA strand breaks. May also play a role in the epigenetic regulation of gene expression by participating in DNA demethylation. Acts as a loading factor for POLB onto non-incised AP sites in DNA and stimulates the 5'-terminal deoxyribose 5'-phosphate (dRp) excision activity of POLB. Plays a role in the protection from granzymes-mediated cellular repair leading to cell death. Also involved in the DNA cleavage step of class switch recombination (CSR) . On the other hand, APEX1 also exerts reversible nuclear redox activity to regulate DNA binding affinity and transcriptional activity of transcriptional factors by controlling the redox status of their DNA-binding domain, such as the FOS/JUN AP-1 complex after exposure to IR. Involved in calcium-dependent down-regulation of parathyroid hormone (PTH) expression by binding to negative calcium response elements (nCaREs) . Together with HNRNPL or the dimer XRCC5/XRCC6, associates with nCaRE, acting as an activator of transcriptional repression. Stimulates the YBX1-mediated MDR1 promoter activity, when acetylated at Lys-6 and Lys-7, leading to drug resistance. Acts also as an endoribonuclease involved in the control of single-stranded RNA metabolism. Plays a role in regulating MYC mRNA turnover by preferentially cleaving in between UA and CA dinucleotides of the MYC coding region determinant (CRD) . In association with NMD1, plays a role in the rRNA quality control process during cell cycle progression. Associates, together with YBX1, on the MDR1 promoter. Together with NPM1, associates with rRNA. Binds DNA and RNA.

Type

Protein

Source

Yeast

Sequence

KNDKEAAGEGPALYEDPPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL

Purification

Affinity purified using IMAC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

Varies by lot. See vial for concentration.

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

34.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

APEX1

Host or Source

Human

Protein Name

DNA- (apurinic or apyrimidinic site) lyase

Gene Name URL

APEX1

Nucleotide Accession Number

NM_001244249.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NIPSNAP3A activation kit by CRISPRa
GA108641 1 Kit

Human NIPSNAP3A activation kit by CRISPRa

Sign In for Pricing
View Details
P2RX4 (NM_002560) Human Over-expression Lysate
LY419264 100 µg

P2RX4 (NM_002560) Human Over-expression Lysate

Sign In for Pricing
View Details
VEGF (Vascular Endothelial Growth Factor) (VG76e), CF405S conjugate, 0.1mg/mL
BNC041687-500 1x 500 µL

VEGF (Vascular Endothelial Growth Factor) (VG76e), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thiorphan
TRC-T369500-5MG 5 mg

Thiorphan

Sign In for Pricing
View Details
FSH beta (FSHb/1062), 0.2mg/mL
BNUB1062-100 1x 100 µL

FSH beta (FSHb/1062), 0.2mg/mL

Sign In for Pricing
View Details
Human RSAD1 activation kit by CRISPRa
GA110697 1 Kit

Human RSAD1 activation kit by CRISPRa

Sign In for Pricing
View Details