Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Annexin A5 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Annexin V; Annexin-5.

Reactivity

Cynops pyrrhogaster

Target

Calcium/phospholipid-binding protein which promotes membrane fusion and is involved in exocytosis.

Type

Protein

Source

Yeast

Sequence

MACLKGAKGTVQDAPDFNDKEDAETLRHAMKGLGTDEDTILKLLISRSNKQRQQIALTYKTLFGRDLTDDLKSELSGKFETLLVALMVPAHLYDACELRNAIKGLGTLENVIIEIMASRTAAEVKNIKETYKKEFDSDLEKDIVGDTSGNFERLLVSLVQANRDPVGKVDEGQVENDAKALFDAGENKWGTDEETFISILSTRGVGHLRKVFDQYMTISGYQIEESIQSETGGHFEKLLLAVVKSIRSIQGYLAE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

30.3 kDa

Protein Length

Recombinant

Host or Source

Cynops pyrrhogaster

Protein Name

Annexin A5

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Myeloid zinc finger 1 (MZF1) activation kit by CRISPRa
GA105227 1 Kit

Human Myeloid zinc finger 1 (MZF1) activation kit by CRISPRa

Sign In for Pricing
View Details
Invadolysin (LMLN) Rabbit Polyclonal Antibody
TA368557 100 µL

Invadolysin (LMLN) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
4- (4-bromophenyl) oxan-4-amine
sc-347952 250 mg

4- (4-bromophenyl) oxan-4-amine

Sign In for Pricing
View Details
4-amino-1H-pyrrole-2-carboxamide hydrochloride
sc-349052 250 mg

4-amino-1H-pyrrole-2-carboxamide hydrochloride

Sign In for Pricing
View Details
Rabbit anti-DAXX Antibody
MBS4506986-01 0.05 mL

Rabbit anti-DAXX Antibody

Sign In for Pricing
View Details
Rabbit anti-DAXX Antibody
MBS4506986-02 0.1 mL

Rabbit anti-DAXX Antibody

Sign In for Pricing
View Details