Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Aif1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Allograft inflammatory factor 1

Gene Aliases

AIF-1; allograft inflammatory factor 1; balloon angioplasty responsive transcript; balloon angioplasty-responsive transcript 1; Bart1; BART-1; iba1; ionized calcium binding adapter molecule 1; Ionized calcium-binding adapter molecule 1; microglia response factor; mrf-1; protein BART-1.

Gene ID

29427

Reactivity

Rat|Rattus norvegicus

Target

Actin-binding protein that enhances membrane ruffling and RAC activation. Enhances the actin-bundling activity of LCP1. Binds calcium. Plays a role in RAC signaling and in phagocytosis. May play an role in macrophage activation and function. Promotes the proliferation of vascular smooth muscle cells and of T-lymphocytes. Enhances lymphocyte migration. Plays a role in vascular inflammation (By similarity) .

Type

Protein

Source

Yeast

Sequence

SQSKDLQGGKAFGLLKAQQEERLDGINKHFLDDPKYSSDEDLQSKLEAFKTKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIREVSSGSEETFSYSDFLRMMLGKRSAILRMILMYEEKNKEHQKPTGPPAKKAISELP

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

18.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Aif1

Host or Source

Rat

Protein Name

Allograft inflammatory factor 1

Gene Name URL

Aif1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Helicobacter Pylori Antibody (HP/212) [Alexa Fluor 594]
NBP3-11570AF594 0.1 mL

Mouse Monoclonal Helicobacter Pylori Antibody (HP/212) [Alexa Fluor 594]

Sign In for Pricing
View Details
CD44 Antibody
MBS8512249-01 0.05 mg

CD44 Antibody

Sign In for Pricing
View Details
CD44 Antibody
MBS8512249-02 0.1 mg

CD44 Antibody

Sign In for Pricing
View Details
CD44 Antibody
MBS8512249-03 0.1 mL (AF750)

CD44 Antibody

Sign In for Pricing
View Details
CD44 Antibody
MBS8512249-04 0.1 mL (AF405M)

CD44 Antibody

Sign In for Pricing
View Details
CD44 Antibody
MBS8512249-05 0.1 mL (AF546)

CD44 Antibody

Sign In for Pricing
View Details