Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MDR1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

P-glycoprotein.

Reactivity

Entamoeba histolytica

Target

Energy-dependent efflux pump responsible for decreased drug accumulation in multidrug-resistant cells.

Type

Protein

Source

Yeast

Sequence

SGCGKSTTIQLIQRNYEPNGGRVTLDGKDIRELNIKWLRNQIGLVGQEPVLFAGTIRENIMLGAKEGETLSKDEMIECAKMANAHEFVSKLAEGYDTLIGEKGALLSGGQRQRI

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

14.5 kda

Protein Length

Recombinant

NCBI Gene Symbol

MDR1

Host or Source

Entamoeba histolytica

Protein Name

Multidrug resistance protein 1

Gene Name URL

MDR1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNA pol λ HDR Plasmid (m)
sc-425243-HDR 20 µg

DNA pol λ HDR Plasmid (m)

Sign In for Pricing
View Details
Human CRTAC1 shRNA Plasmid
abx960481-01 150 µg

Human CRTAC1 shRNA Plasmid

Sign In for Pricing
View Details
Human CRTAC1 shRNA Plasmid
abx960481-02 300 µg

Human CRTAC1 shRNA Plasmid

Sign In for Pricing
View Details
Cryab sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4447302 1.0 µg DNA

Cryab sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Staphylococcus aureus Enterotoxin C Antibody
abx022256 1 mg

Staphylococcus aureus Enterotoxin C Antibody

Sign In for Pricing
View Details
Guinea Pig Sialic acid-binding Ig-like lectin 6 ELISA kit
GTR10405403 96 Well

Guinea Pig Sialic acid-binding Ig-like lectin 6 ELISA kit

Sign In for Pricing
View Details