What is the catalog number for NIP7 Recombinant Protein?

The catalog number for NIP7 Recombinant Protein is OPCA02565-1MG.

What sizes are available for NIP7 Recombinant Protein?

NIP7 Recombinant Protein is available in the following size(s): 1 mg.

Is NIP7 Recombinant Protein in stock?

NIP7 Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

What is the molecular weight of the target protein?

Molecular weight information, where applicable, is listed on the datasheet under target details, useful for confirming the correct band on western blot.

NIP7 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Nucleolar pre-rRNA processing protein NIP7

Gene Aliases

60S ribosome subunit biogenesis protein NIP7 homolog; CGI-37; HSPC031; KD93; NIP7, nucleolar pre-rRNA processing protein; nuclear import 7 homolog.

Gene ID

51388

Accession Number

NP_001186363.1

Reactivity

Homo sapiens|Human

Target

Required for proper 34S pre-rRNA processing and 60S ribosome subunit assembly.

Type

Protein

Source

E.coli

Sequence

MRPLTEEETRVMFEKIAKYIGENLQLLVDRPDGTYCFRLHNDRVYYVSEKIMKLAANISGDKLVSLGTCFGKFTKTHKFRLHVTALDYLAPYAKYKVWIKPGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETLT

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

36.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

NIP7

Host or Source

Human

Protein Name

60S ribosome subunit biogenesis protein NIP7 homolog

Gene Name URL

NIP7

Nucleotide Accession Number

NM_001199434.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BNC701052-500 1x 500 µL