Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wisp2 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Cellular communication network factor 5

Gene Aliases

CCN; CCN family member 5; connective tissue growth factor-like protein; Crg; Crgr4; Ctgfl; CTGF-L; rC; Rcop1; Wi; Wisp2; WISP-2; WNT1 inducible signaling pathway protein 2.

Gene ID

22403

Accession Number

NP_058569.2

Reactivity

Mouse|Mus musculus

Target

May play an important role in modulating bone turnover. Promotes the adhesion of osteoblast cells and inhibits the binding of fibrinogen to integrin receptors. In addition, inhibits osteocalcin production (By similarity) .

Type

Protein

Source

E.coli

Sequence

QLCPAPCACPWTPPQCPPGVPLVLDGCGCCRVCARRLGESCDHLHVCDPSQGLVCQPGAGPSGRGAVCLFEEDDGSCEVNGRRYLDGETFKPNCRVLCRCDDGGFTCLPLCSEDVRLPSWDCPRPRRIQVPGRCCPEWVCDQAVMQPAIQPSSAQGHQLSALVTPASADGPCPNWSTAWGPCSTTCGLGIATRVSNQNRFCQLEIQRRLCLSRPCLASRSHGSWNSAF

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

40.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Ccn5

Host or Source

Mouse

Protein Name

WNT1-inducible-signaling pathway protein 2

Gene Name URL

Ccn5

Nucleotide Accession Number

NM_016873.2

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADPN (D-5) Alexa Fluor® 680
sc-390251 AF680 200 µg/mL

ADPN (D-5) Alexa Fluor® 680

Sign In for Pricing
View Details
AF647 Mouse IgG3, κ Isotype Control
RD30029F-01 20 Tests

AF647 Mouse IgG3, κ Isotype Control

Sign In for Pricing
View Details
AF647 Mouse IgG3, κ Isotype Control
RD30029F-02 100 Tests

AF647 Mouse IgG3, κ Isotype Control

Sign In for Pricing
View Details
AF647 Mouse IgG3, κ Isotype Control
RD30029F-03 2x 100 Tests

AF647 Mouse IgG3, κ Isotype Control

Sign In for Pricing
View Details
Rabbit anti-Saccharomyces cerevisiae (strain Lalvin EC1118/Prise de mousse)(Baker's yeast) STS1 Polyclonal Antibody
MBS7178902 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain Lalvin EC1118/Prise de mousse)(Baker's yeast) STS1 Polyclonal Antibody

Sign In for Pricing
View Details
Human PIBF (Progesterone Induced Blocking Factor) ELISA Kit
EKE61052 96 Tests

Human PIBF (Progesterone Induced Blocking Factor) ELISA Kit

Sign In for Pricing
View Details