Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP2R3B Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Protein phosphatase 2 regulatory subunit B''beta

Gene Aliases

NYREN8; NY-REN-8 antigen; PP2A subunit B isoform PR48; PPP2R3L; PPP2R3LY; PR48; PR70; protein phosphatase 2 (formerly 2A), regulatory subunit B'', beta; protein phosphatase 2, regulatory subunit B'', beta; Protein phosphatase 2A 48 kDa regulatory subunit; serine/threonine protein phosphatase 2A, 48kDa regulatory subunit B; serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta.

Gene ID

28227

Accession Number

NP_037371.2

Reactivity

Homo sapiens|Human

Target

The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment.

Type

Protein

Source

E.coli

Sequence

MDLDGDGALSMFELEYFYEEQCRRLDSMAIEALPFQDCLCQMLDLVKPRTEGKITLQDLKRCKLANVFFDTFFNIEKYLDHEQKEQISLLRDGDSGGPELSDWEKYAAEEYDILVAEETAGEPWEDGFEAELSPVEQKLSALRSPLAQRPFFEAPSPLGAVDLYEYACGDEDLEPL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

36.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PPP2R3B

Host or Source

Human

Protein Name

Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta

Gene Name URL

PPP2R3B

Nucleotide Accession Number

NM_013239.4

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Folr2 activation kit by CRISPRa
GA201462 1 Kit

Mouse Folr2 activation kit by CRISPRa

Sign In for Pricing
View Details
ASIC5 Antibody
orb1242724 100 µL

ASIC5 Antibody

Sign In for Pricing
View Details
AKT Serine/threonine Kinase 1 Phospho-Thr450 (AKT1 pT450) Antibody
abx328929-01 50 µg

AKT Serine/threonine Kinase 1 Phospho-Thr450 (AKT1 pT450) Antibody

Sign In for Pricing
View Details
AKT Serine/threonine Kinase 1 Phospho-Thr450 (AKT1 pT450) Antibody
abx328929-02 100 µg

AKT Serine/threonine Kinase 1 Phospho-Thr450 (AKT1 pT450) Antibody

Sign In for Pricing
View Details
Levofloxacin 5 µg
7056 5x 50 Discs

Levofloxacin 5 µg

Sign In for Pricing
View Details
BLNK (Phospho-Tyr84) Antibody
orb251744-01 50 μL

BLNK (Phospho-Tyr84) Antibody

Sign In for Pricing
View Details