What is the catalog number for PPP2R3B Recombinant Protein?

The catalog number for PPP2R3B Recombinant Protein is OPCA02556-1MG.

What sizes are available for PPP2R3B Recombinant Protein?

PPP2R3B Recombinant Protein is available in the following size(s): 1 mg.

Is PPP2R3B Recombinant Protein in stock?

PPP2R3B Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

What do I do if this product arrives with reduced ice or a damaged cold-chain package?

Report this to us immediately with photos and your order reference. Our specialists will assess whether the product is still usable given the cold-chain interruption, and will arrange a replacement or credit if it isn’t.

What host species was used to raise this antibody?

The host species used in production is listed under product specifications on the datasheet, and is relevant when selecting a compatible secondary antibody for your assay.

What is the difference between this product and a similar catalogue number?

Differences typically involve clone, conjugate, host species, or validated applications. Compare the respective datasheets, or contact us with both catalogue numbers for a direct comparison.

PPP2R3B Recombinant Protein

Selected Variant

OPCA02556-1MG

Size: 1 mg

Product Specifications

CAS Number

9000-83-3

Gene Name

Protein phosphatase 2 regulatory subunit B''beta

Gene Aliases

NYREN8; NY-REN-8 antigen; PP2A subunit B isoform PR48; PPP2R3L; PPP2R3LY; PR48; PR70; protein phosphatase 2 (formerly 2A), regulatory subunit B'', beta; protein phosphatase 2, regulatory subunit B'', beta; Protein phosphatase 2A 48 kDa regulatory subunit; serine/threonine protein phosphatase 2A, 48kDa regulatory subunit B; serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta.

Gene ID

28227

Accession Number

NP_037371.2

Reactivity

Homo sapiens|Human

Target

The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment.

Type

Protein

Source

E.coli

Sequence

MDLDGDGALSMFELEYFYEEQCRRLDSMAIEALPFQDCLCQMLDLVKPRTEGKITLQDLKRCKLANVFFDTFFNIEKYLDHEQKEQISLLRDGDSGGPELSDWEKYAAEEYDILVAEETAGEPWEDGFEAELSPVEQKLSALRSPLAQRPFFEAPSPLGAVDLYEYACGDEDLEPL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

36.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PPP2R3B

Host or Source

Human

Protein Name

Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta

Gene Name URL

PPP2R3B

Nucleotide Accession Number

NM_013239.4

Price

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HPV-16 (Human Papilloma Virus 16) (HPV16/1295), 0.2mg/mL

BNUB1295-100 1x 100 µL