Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMM10B Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Translocase of inner mitochondrial membrane 10B

Gene Aliases

Fracture callus 1 homolog; fracture callus protein 1; FXC1; mitochondrial import inner membrane translocase subunit Tim10 B; mitochondrial import inner membrane translocase subunit Tim9 B; TIM10B; Tim9b; TIMM10B; translocase of inner mitochondrial membrane 10 homolog B.

Gene ID

26515

Accession Number

NP_036324.1

Reactivity

Homo sapiens|Human

Target

Component of the TIM22 complex, a complex that mediates the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. The TIM22 complex forms a twin-pore translocase that uses the membrane potential as the external driving force. In the TIM22 complex, it may act as a docking point for the soluble 70 kDa complex that guides the target proteins in transit through the aqueous mitochondrial intermembrane space.

Type

Protein

Source

E.coli

Sequence

MERQQQQQQQLRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLIHSNHRLMAAYVQLMPALVQRRIADYEAASAVPGVAAEQPGVSPSGS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

27.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

TIMM10B

Host or Source

Human

Protein Name

Mitochondrial import inner membrane translocase subunit Tim10 B

Gene Name URL

TIMM10B

Nucleotide Accession Number

NM_012192.3

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tau, phosphorylated (Ser396)
T1040-02G 100 µL

Tau, phosphorylated (Ser396)

Sign In for Pricing
View Details
SMURF2 Antibody
A68325-100UG 100 µg

SMURF2 Antibody

Sign In for Pricing
View Details
TNMD-set siRNA/shRNA/RNAi Lentivector (Human)
47242091 4x 500 ng

TNMD-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
GADD45G Mouse Monoclonal Antibody [Clone ID: LBI4E5]
AMM13253V 100 µL

GADD45G Mouse Monoclonal Antibody [Clone ID: LBI4E5]

Sign In for Pricing
View Details
Midkine Recombinant Antibody, PE-Cy7 Conjugated
bsm-61219R-PE-Cy7-01 20 µL

Midkine Recombinant Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
Midkine Recombinant Antibody, PE-Cy7 Conjugated
bsm-61219R-PE-Cy7-02 100 µL

Midkine Recombinant Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details