Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAD18 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

RAD18 E3 ubiquitin protein ligase

Gene Aliases

E3 ubiquitin-protein ligase RAD18; hHR18; hRAD18; postreplication repair protein hRAD18p; postreplication repair protein RAD18; RAD18 homolog; RAD18, S. cerevisiae, homolog; RING finger protein 73; RING-type E3 ubiquitin transferase RAD18; RNF73.

Gene ID

56852

Accession Number

NP_064550.3

Reactivity

Homo sapiens|Human

Target

E3 ubiquitin-protein ligase involved in postreplication repair of UV-damaged DNA. Postreplication repair functions in gap-filling of a daughter strand on replication of damaged DNA. Associates to the E2 ubiquitin conjugating enzyme UBE2B to form the UBE2B-RAD18 ubiquitin ligase complex involved in mono-ubiquitination of DNA-associated PCNA on 'Lys-164'. Has ssDNA binding activity.

Type

Protein

Source

E.coli

Sequence

MDSLAESRWPPGLAVMKTIDDLLRCGICFEYFNIAMIIPQCSHNYCSLCIRKFLSYKTQCPTCCVTVTEPDLKNNRILDELVKSLNFARNHLLQFALESPAKSPASSSSKNLAVKVYTPVASRQSLKQGSRLMDNFLIREMSGSTSELLIKENKSKFSPQKEASPAAKTKETRSVEEIAPDPSEAKRPEPPSTSTLKQVTKVDCPVCGVNIPESHINKHLDSCLSREEKKESLRSSVHKRKPLPKTVYNLLSDRDLKKKLKEHGLSIQGNKQQLIKRHQEFVHMYNAQCDALHPKSAAEIVREIENIEKTRMRLEASKLNESVMVFTKDQTEKEIDEIHSKYRKKHKSEFQLLVDQARKGYKKIAGMSQKTVTITKEDESTEKLSSVCMGQEDNMTSVTNHFSQSKLDSPEELEPDREEDSSSCIDIQEVLSSSESDSCNSSSSDIIRDLLEEEEAWEASHKNDLQDTEISPRQNRRTRAAESAEIEPRNKRNRN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

72.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

RAD18

Host or Source

Human

Protein Name

E3 ubiquitin-protein ligase RAD18

Gene Name URL

RAD18

Nucleotide Accession Number

NM_020165.3

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Copine 2 (CPNE2) ELISA Kit
GTR10359341 96 Well

Canine Copine 2 (CPNE2) ELISA Kit

Sign In for Pricing
View Details
ZNF526 sgRNA CRISPR Lentivector set (Human)
K2712201 3x 1.0 µg

ZNF526 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Rat Trx (Thioredoxin) ELISA Kit
MBS8800999-01 48 Well

Rat Trx (Thioredoxin) ELISA Kit

Sign In for Pricing
View Details
Rat Trx (Thioredoxin) ELISA Kit
MBS8800999-02 96 Well

Rat Trx (Thioredoxin) ELISA Kit

Sign In for Pricing
View Details
Rat Trx (Thioredoxin) ELISA Kit
MBS8800999-03 5x 96 Well

Rat Trx (Thioredoxin) ELISA Kit

Sign In for Pricing
View Details
Rat Trx (Thioredoxin) ELISA Kit
MBS8800999-04 10x 96 Well

Rat Trx (Thioredoxin) ELISA Kit

Sign In for Pricing
View Details