Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRMT112 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

TRNA methyltransferase activator subunit 11-2

Gene Aliases

HSPC152; HSPC170; hTrm112; multifunctional methyltransferase subunit TRM112-like protein; TRM112; TRM112-like protein; TRMT11-2; tRNA methyltransferase 112 homolog; tRNA methyltransferase 11-2 homolog; tRNA methyltransferase subunit 11-2.

Gene ID

51504

Accession Number

NP_001273011.1

Reactivity

Homo sapiens|Human

Target

Acts as an activator of both rRNA/tRNA and protein methyltransferases (PubMed:25851604) . Together with methyltransferase BUD23, methylates the N (7) position of a guanine in 18S rRNA (PubMed:25851604) . The heterodimer with HEMK2/N6AMT1 catalyzes N5-methylation of ETF1 on 'Gln-185', using S-adenosyl L-methionine as methyl donor (PubMed:18539146) . The heterodimer with ALKBH8 catalyzes the methylation of 5-carboxymethyl uridine to 5-methylcarboxymethyl uridine at the wobble position of the anticodon loop in target tRNA species (PubMed:20308323) . Involved in the pre-rRNA processing steps leading to small-subunit rRNA production (PubMed:25851604) .

Type

Protein

Source

E.coli

Sequence

MKLLTHNLLSSHVRGVGSRGFPLRLQATEVRICPVEFNPNFVARMIPKVEWSAFLEAADNLRLIQVPKGPVEGYEENEEFLRTMHHLLLEVEVIEGTLQCPESGRMFPISRGIPNMLLSEEETES

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

30.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

TRMT112

Host or Source

Human

Protein Name

Multifunctional methyltransferase subunit TRM112-like protein

Gene Name URL

TRMT112

Nucleotide Accession Number

NM_001286082.1

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Centrin-2 Antibody
MBS9241200-01 0.05 mL

Anti-Centrin-2 Antibody

Sign In for Pricing
View Details
Anti-Centrin-2 Antibody
MBS9241200-02 0.1 mL

Anti-Centrin-2 Antibody

Sign In for Pricing
View Details
Anti-Centrin-2 Antibody
MBS9241200-03 5x 0.1 mL

Anti-Centrin-2 Antibody

Sign In for Pricing
View Details
GFP hsa-mir-1258 AAV miRNA Vector
Amh1008500 500 ng

GFP hsa-mir-1258 AAV miRNA Vector

Sign In for Pricing
View Details
Tert-butyl 2-fluoro-3,4-dimethoxybenzoate
PC1019336-01 250 mg

Tert-butyl 2-fluoro-3,4-dimethoxybenzoate

Sign In for Pricing
View Details
Tert-butyl 2-fluoro-3,4-dimethoxybenzoate
PC1019336-02 500 mg

Tert-butyl 2-fluoro-3,4-dimethoxybenzoate

Sign In for Pricing
View Details