Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

XPNPEP1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

X-prolyl aminopeptidase 1

Gene Aliases

Aminoacylproline aminopeptidase; aminopeptidase P, cytosolic; APP1; cytosolic aminopeptidase P; SAMP; soluble aminopeptidase P; xaa-Pro aminopeptidase 1; XPNPEP; XPNPEPL; XPNPEPL1; X-Pro aminopeptidase 1; X-prolyl aminopeptidase (aminopeptidase P) 1, soluble; X-prolyl aminopeptidase 1, soluble.

Gene ID

7511

Accession Number

NP_001161076.1

Reactivity

Homo sapiens|Human

Target

Contributes to the degradation of bradykinin. Catalyzes the removal of a penultimate prolyl residue from the N-termini of peptides, such as Arg-Pro-Pro.

Type

Protein

Source

E.coli

Sequence

PPKVTSELLRQLRQAMRNSEYVTEPIQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSAGTAIITEEHAAMWTDGRYFLQAAKQMDSNWTLMKMGLKDTPTQEDWLVSVLPEGSRVGVDPLIIPTDYWKKMAKVLRSAGHHLIPVKENLVDKIWTDRPERPCKPLLTLGLDYTGISWKDKVADLRLKMAERNVMWFVVTALDEIAWLFNLRGSDVEHNPVFFSYAIIGLETIMLFIDGDRIDAPSVKEHLLLDLGLEAEYRIQVHPYKSILSELKALCADLSPREKVWVSDKASYAVSETIPKDHRCCMPYTPICIAKAVKNSAESEGMRRAHIKDAVALCELFNWLEKEVPKGGVTEISAADKAEEFRRQQADFVDLSFPTISSTGPNGAIIHYAPVPETNRTLSLDEVYLIDSGAQYKDGTTDVTRTMHFGTPTAYEKECFTYVLKGHIAVSAAVFPTGTKGHLLDSFARSALWDSGLDYLHGTGHGVGSFLNVHEGPCGISYKTFSDEPLEAGMIVTDEPGYYEDGAFGIRIENVVLVVPVKTKYNFNNRGSLTFEPLTLVPIQTKMIDVDSLTDKECDWLNNYHLTCRDVIGKELQKQGRQEALEWLIRETQPISKQH

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

85.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

XPNPEP1

Host or Source

Human

Protein Name

Xaa-Pro aminopeptidase 1

Gene Name URL

XPNPEP1

Nucleotide Accession Number

NM_001167604.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp639 sgRNA CRISPR Lentivector (Rat) (Target 3)
K6571204 1.0 µg DNA

Zfp639 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
CPNE7 Rabbit Polyclonal Antibody (RBITC)
orb1063778 100 µL

CPNE7 Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details
CPNE1 (Copine I, Copine-1, COPN1, CPN1, MGC1142) (MaxLight 490)
MBS6400235-01 0.1 mL

CPNE1 (Copine I, Copine-1, COPN1, CPN1, MGC1142) (MaxLight 490)

Sign In for Pricing
View Details
CPNE1 (Copine I, Copine-1, COPN1, CPN1, MGC1142) (MaxLight 490)
MBS6400235-02 5x 0.1 mL

CPNE1 (Copine I, Copine-1, COPN1, CPN1, MGC1142) (MaxLight 490)

Sign In for Pricing
View Details
TBX3, ID (TBX3, T-box transcription factor TBX3) (MaxLight 750) discontinued
042668-ML750 100 µL

TBX3, ID (TBX3, T-box transcription factor TBX3) (MaxLight 750) discontinued

Sign In for Pricing
View Details
UROS Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV624537 1.0 µg DNA

UROS Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details