Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MOB1A Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

MOB kinase activator 1A

Gene Aliases

C2orf6; MABKL1B; MATS1; MOB kinase activator 1A; MOB1; mob1 alpha; mob1 homolog 1B; MOB1 Mps One Binder homolog A; MOB1, Mps One Binder kinase activator-like 1B; Mob4B; MOBK1B; MOBKL1B; mps one binder kinase activator-like 1B.

Gene ID

55233

Accession Number

NP_060691.2

Reactivity

Homo sapiens|Human

Target

Activator of LATS1/2 in the Hippo signaling pathway which plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Phosphorylation of YAP1 by LATS1/2 inhibits its translocation into the nucleus to regulate cellular genes important for cell proliferation, cell death, and cell migration. Stimulates the kinase activity of STK38 and STK38L. Acts cooperatively with STK3/MST2 to activate STK38.

Type

Protein

Source

E.coli

Sequence

SFLFSSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRQAVMLPEGEDLNEWIAVNTVDFFNQINMLYGTITEFCTEASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLGSKDR

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

40.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

MOB1A

Host or Source

Human

Protein Name

MOB kinase activator 1A

Gene Name URL

MOB1A

Nucleotide Accession Number

NM_018221.4

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human thrombin ELISA KIT
EF000371 96 Tests

Human thrombin ELISA KIT

Sign In for Pricing
View Details
DMAP1 (NM_001034023) Human Over-expression Lysate
LH04570V 100 µg

DMAP1 (NM_001034023) Human Over-expression Lysate

Sign In for Pricing
View Details
TIGIT Rabbit pAb
A25605-01 20 µL

TIGIT Rabbit pAb

Sign In for Pricing
View Details
TIGIT Rabbit pAb
A25605-02 100 μL

TIGIT Rabbit pAb

Sign In for Pricing
View Details
TIGIT Rabbit pAb
A25605-03 500 μL

TIGIT Rabbit pAb

Sign In for Pricing
View Details
TIGIT Rabbit pAb
A25605-04 1000 μL

TIGIT Rabbit pAb

Sign In for Pricing
View Details