Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

N16.1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

N14#1.

Reactivity

Pinctada fucata

Target

May be specifically involved in the formation of the nacreous layer.

Type

Protein

Source

E.coli

Sequence

AYHKKCGRYSYCWIPYDIERDRRDNGGKKYCFCRYAWSPWQCNEEERYEWLRCGMRFYSLCCYTDDDNGNGNGNGNGNGLNYLKSLYGGYGNGNGEFREEYIDERYDN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

28.9 kDa

Protein Length

Recombinant

Host or Source

Pinctada fucata

Protein Name

N16.1 matrix protein

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cpne3 (NM_001107917) Rat Tagged ORF Clone
RR204822 10 µg

Cpne3 (NM_001107917) Rat Tagged ORF Clone

Sign In for Pricing
View Details
PiggyBac-CMV-NTRK2-a-EF1a-Puro Plasmid
PVT43230 2 µg

PiggyBac-CMV-NTRK2-a-EF1a-Puro Plasmid

Sign In for Pricing
View Details
Mouse Monoclonal GSK-3 beta Antibody (3D10) [HRP]
NBP1-47470H 0.1 mL

Mouse Monoclonal GSK-3 beta Antibody (3D10) [HRP]

Sign In for Pricing
View Details
Cytokeratin 7 Polyclonal Antibody
ABP51135-01 30 µL

Cytokeratin 7 Polyclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 7 Polyclonal Antibody
ABP51135-02 100 µL

Cytokeratin 7 Polyclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 7 Polyclonal Antibody
ABP51135-03 200 µL

Cytokeratin 7 Polyclonal Antibody

Sign In for Pricing
View Details