Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DYNLRB1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Dynein light chain roadblock-type 1

Gene Aliases

BITH; bithoraxoid-like protein; BLP; DNCL2A; DNLC2A; Dynein light chain 2A, cytoplasmic; dynein light chain roadblock-type 1; dynein, cytoplasmic, light polypeptide 2A; dynein-associated protein Km23; roadblock domain-containing protein 1; ROBL/LC7-like 1; ROBLD1.

Gene ID

83658

Accession Number

NP_001268656.1

Reactivity

Homo sapiens|Human

Target

Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules.

Type

Protein

Source

E.coli

Sequence

EVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQNPTE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

26.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

DYNLRB1

Host or Source

Human

Protein Name

Dynein light chain roadblock-type 1

Gene Name URL

DYNLRB1

Nucleotide Accession Number

NM_001281727.1

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAPSS2 antibody
FNab06143 100 µg

PAPSS2 antibody

Sign In for Pricing
View Details
Chicken Protein TENP, TENP ELISA KIT
ELI-23246c 96 Tests

Chicken Protein TENP, TENP ELISA KIT

Sign In for Pricing
View Details
MT-CO3 polyclonal antibody
orb1719307-01 50 µL

MT-CO3 polyclonal antibody

Sign In for Pricing
View Details
MT-CO3 polyclonal antibody
orb1719307-02 100 µL

MT-CO3 polyclonal antibody

Sign In for Pricing
View Details
Cntn6 sgRNA CRISPR Lentivector set (Rat)
K6831001 3x 1.0 µg

Cntn6 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Rfxank Mouse qPCR Primer Pair (NM_011266)
MP212597 200 Reactions

Rfxank Mouse qPCR Primer Pair (NM_011266)

Sign In for Pricing
View Details