Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

L2HGDH Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

L-2-hydroxyglutarate dehydrogenase

Gene Aliases

2-hydroxyglutarate dehydrogenase; alpha-hydroxyglutarate oxidoreductase; alpha-ketoglutarate reductase; C14orf160; duranin; L2HGA; L-2-hydroxyglutarate dehydrogenase, mitochondrial; L-alpha-hydroxyglutarate dehydrogenase.

Gene ID

79944

Accession Number

NP_079160.1

Reactivity

Homo sapiens|Human

Target

This gene encodes L-2-hydroxyglutarate dehydrogenase, a FAD-dependent enzyme that oxidizes L-2-hydroxyglutarate to alpha-ketoglutarate in a variety of mammalian tissues. Mutations in this gene cause L-2-hydroxyglutaric aciduria, a rare autosomal recessive neurometabolic disorder resulting in moderate to severe mental retardation.

Type

Protein

Source

E.coli

Sequence

VIVGGGIVGLASARALILRHPSLSIGVLEKEKDLAVHQTGHNSGVIHSGIYYKPESLKAKLCVQGAALLYEYCQQKGISYKQCGKLIVAVEQEEIPRLQALYEKGLQNGVPGLRLIQQEDIKKKEPYCRGLMAIDCPHTGIVDYRQVALSFAQDFQEAGGSVLTNFEVKGIEMAKESPSRSIDGMQYPIVIKNTKGEEIRCQYVVTCAGLYSDRISELSGCTPDPRIVPFRGDYLLLKPEKCYLVKGNIYPVPDSRFPFLGVHFTPRMDGSIWLGPNAVLAFKREGYRPFDFSATDVMDIIINSGLIKLASQNFSYGVTEMYKACFLGATVKYLQKFIPEITISDILRGPAGVRAQALDRDGNLVEDFVFDAGVGDIGNRILHVRNAPSPAATSSIAISGMIADEVQQRFEL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

61.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

L2HGDH

Host or Source

Human

Protein Name

L-2-hydroxyglutarate dehydrogenase, mitochondrial

Gene Name URL

L2HGDH

Nucleotide Accession Number

NM_024884.2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C19orf34 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV809314 1.0 µg DNA

C19orf34 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Dehydroxy Vildagliptin
TRC-D357360-500MG 500 mg

Dehydroxy Vildagliptin

Sign In for Pricing
View Details
Solute Carrier Family 16, Member 1 (SLC16A1) Magnetic Fluorescence Assay Kit
MBS2159803-01 96 Tests

Solute Carrier Family 16, Member 1 (SLC16A1) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Solute Carrier Family 16, Member 1 (SLC16A1) Magnetic Fluorescence Assay Kit
MBS2159803-02 5x 96 Tests

Solute Carrier Family 16, Member 1 (SLC16A1) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Solute Carrier Family 16, Member 1 (SLC16A1) Magnetic Fluorescence Assay Kit
MBS2159803-03 10x 96 Tests

Solute Carrier Family 16, Member 1 (SLC16A1) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
HDAC9 (NM_178423) Human Tagged ORF Clone
RG218061 10 µg

HDAC9 (NM_178423) Human Tagged ORF Clone

Sign In for Pricing
View Details