What is the catalog number for PLA2G12A Recombinant Protein?

The catalog number for PLA2G12A Recombinant Protein is OPCA02465-20UG.

What sizes are available for PLA2G12A Recombinant Protein?

PLA2G12A Recombinant Protein is available in the following size(s): 20 µg.

Is PLA2G12A Recombinant Protein in stock?

PLA2G12A Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

Can I request additional validation data, such as western blot images, for this product?

Additional data may be available on request. Contact our technical support team with the catalogue number and we’ll check what supporting documentation the supplier can provide.

What documentation should I request if this product is used for a regulated or intellectual-property-sensitive application?

If the product is subject to intellectual property protections, we’ll advise on any MTA or usage restrictions before shipping. Let us know your intended end use so we can confirm what’s required upfront.

Is this antibody conjugated?

Conjugation status, such as unconjugated, HRP, FITC, or biotin, is specified in the product name and confirmed on the datasheet.

PLA2G12A Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Phospholipase A2, group XIIA

Gene Aliases

2310004B05Rik; group XII-1 phospholipase A2; group XIIA secreted phospholipase A2; group XIIA secretory phospholipase A2; GX; GXII; GXII-1; GXII-1-PLA2; mGXII; mGXII-1; phosphatidylcholine 2-acylhydrolase 12A; Pla2; Pla2g12; R; Rossy.

Gene ID

66350

Accession Number

NP_075685.2

Reactivity

Mouse|Mus musculus

Target

PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. Does not exhibit detectable activity toward sn-2-arachidonoyl- or linoleoyl-phosphatidylcholine or -phosphatidylethanolamine (By similarity) .

Type

Protein

Source

E.coli

Sequence

QEQDQTTDWRATLKTIRNGIHKIDTYLNAALDLLGGEDGLCQYKCSDGSKPVPRYGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLSQNVQACETTVELLFDSVIHLGCKPYLDSQRAACWCRYEEKTDL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.