Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL20 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Mitochondrial ribosomal protein L20

Gene Aliases

39S ribosomal protein L20, mitochondrial; L20mt; mitochondrial large ribosomal subunit protein bL20m; MRP-L20.

Gene ID

55052

Accession Number

NP_060441.2

Reactivity

Homo sapiens|Human

Target

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. A pseudogene corresponding to this gene is found on chromosome 21q. Alternative splicing results in multiple transcript variants encoding different isoforms.

Type

Protein

Source

E.coli

Sequence

VIRAFVKCTKARYLKKKNMRTLWINRITAASQEHGLKYPALIGNLVKCQVELNRKVLADLAIYEPKTFKSLAALASRRRHEGFAAALGDGKEPEGIFSRVVQYH

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

27.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

MRPL20

Host or Source

Human

Protein Name

39S ribosomal protein L20, mitochondrial

Gene Name URL

MRPL20

Nucleotide Accession Number

NM_017971.3

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Il18bp (NM_010531) Mouse Tagged ORF Clone
MG201876 10 µg

Il18bp (NM_010531) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
ANT1/ANT2/ANT3/ANT4 Polyclonal Conjugated Antibody
orb1627293 100 µL

ANT1/ANT2/ANT3/ANT4 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
IFNAR2 Recombinant Protein (Human)
OPCA03881-100UG 100 µg

IFNAR2 Recombinant Protein (Human)

Sign In for Pricing
View Details
NUB1 siRNA (Human)
MBS8218950-01 15 nmol

NUB1 siRNA (Human)

Sign In for Pricing
View Details
NUB1 siRNA (Human)
MBS8218950-02 30 nmol

NUB1 siRNA (Human)

Sign In for Pricing
View Details
NUB1 siRNA (Human)
MBS8218950-03 5x 30 nmol

NUB1 siRNA (Human)

Sign In for Pricing
View Details