Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DUSP26 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Dual specificity phosphatase 26

Gene Aliases

DSP-4; dual specificity phosphatase 26 (putative) ; dual specificity phosphatase SKRP3; dual specificity protein phosphatase 26; DUSP24; LDP4; LDP-4; low-molecular-mass dual-specificity phosphatase 4; MAP kinase phosphatase 8; mitogen-activated protein kinase phosphatase 8; MKP8; MKP-8; NATA1; NEAP; neuroendocrine-associated phosphatase; Novel amplified gene in thyroid anaplastic cancer; SKRP3.

Gene ID

78986

Accession Number

NP_001292044.1

Reactivity

Homo sapiens|Human

Target

Inactivates MAPK1 and MAPK3 which leads to dephosphorylation of heat shock factor protein 4 and a reduction in its DNA-binding activity. Inhibits MAP kinase p38 by dephosphorylating it and inhibits p38-mediated apoptosis in anaplastic thyroid cancer cells. Can also induce activation of MAP kinase p38 and c-Jun N-terminal kinase (JNK) .

Type

Protein

Source

E.coli

Sequence

MCPGNWLWASMTFMARFSRSSSRSPVRTRGTLEEMPTVQHPFLNVFELERLLYTGKTACNHADEVWPGLYLGDQDMANNRRELRRLGITHVLNASHSRWRGTPEAYEGLGIRYLGVEAHDSPAFDMSIHFQTAADFIHRALSQPGGKILVHCAVGVSRSATLVLAYLMLYHHLTLVEAIKKVKDHRGIIPNRGFLRQLLALDRRLRQGLEA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

39.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

DUSP26

Host or Source

Human

Protein Name

Dual specificity protein phosphatase 26

Gene Name URL

DUSP26

Nucleotide Accession Number

NM_001305115.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ss18 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6734505 3x 1.0 µg

Ss18 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
γ Enolase CRISPR/Cas9 KO Plasmid (m2)
sc-420179-KO-2 20 µg

γ Enolase CRISPR/Cas9 KO Plasmid (m2)

Sign In for Pricing
View Details
Neopterin) Rabbit ELISA Kit
F3020 96 Tests

Neopterin) Rabbit ELISA Kit

Sign In for Pricing
View Details
SETX (h) -PR
sc-92842-PR 10 µM - 20 µL

SETX (h) -PR

Sign In for Pricing
View Details
UBE2C Protein Vector (Human) (pPM-C-His)
PV044900 500 ng

UBE2C Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
PIPOX siRNA Oligos set (Human)
36718171 3x 5 nmol

PIPOX siRNA Oligos set (Human)

Sign In for Pricing
View Details