What is the catalog number for DBNDD2 Recombinant Protein?

The catalog number for DBNDD2 Recombinant Protein is OPCA02462-1MG.

What sizes are available for DBNDD2 Recombinant Protein?

DBNDD2 Recombinant Protein is available in the following size(s): 1 mg.

Is DBNDD2 Recombinant Protein in stock?

DBNDD2 Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

What documentation should I request if this product is used for a regulated or intellectual-property-sensitive application?

If the product is subject to intellectual property protections, we’ll advise on any MTA or usage restrictions before shipping. Let us know your intended end use so we can confirm what’s required upfront.

Is this antibody conjugated?

Conjugation status, such as unconjugated, HRP, FITC, or biotin, is specified in the product name and confirmed on the datasheet.

What is the sensitivity of this ELISA kit?

Assay sensitivity, including the minimum detectable dose, is listed on the datasheet. Kits that are assembled on order typically ship within 2-4 weeks.

DBNDD2 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Dysbindin domain containing 2

Gene Aliases

C20orf35; casein kinase-1 binding protein; CK1BP; dysbindin (dystrobrevin binding protein 1) domain containing 2; dysbindin domain-containing protein 2; HSMNP1; SCF apoptosis response protein 1.

Gene ID

55861

Accession Number

NP_001041686.1

Reactivity

Homo sapiens|Human

Target

May modulate the activity of casein kinase-1. Inhibits CSNK1D autophosphorylation (in vitro) .

Type

Protein

Source

E.coli

Sequence

MDPNPRAALERQQLRLRERQKFFEDILQPETEFVFPLSHLHLESQRPPIGSISSMEVNVDTLEQVELIDLGDPDAADVFLPCEDPPPTPQSSGMDNHLEELSLPVPTSDRTTSRTSSSSSSDSSTNLHSPNPSDDGADTPLAQSDEEEERGDGGAEPGACS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.