Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GEMIN7 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Gem nuclear organelle associated protein 7

Gene Aliases

Gem-associated protein 7; gemin-7; SIP3.

Gene ID

79760

Accession Number

NP_001007270.1

Reactivity

Homo sapiens|Human

Target

The SMN complex plays a catalyst role in the assembly of small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Thereby, plays an important role in the splicing of cellular pre-mRNAs. Most spliceosomal snRNPs contain a common set of Sm proteins SNRPB, SNRPD1, SNRPD2, SNRPD3, SNRPE, SNRPF and SNRPG that assemble in a heptameric protein ring on the Sm site of the small nuclear RNA to form the core snRNP. In the cytosol, the Sm proteins SNRPD1, SNRPD2, SNRPE, SNRPF and SNRPG are trapped in an inactive 6S pICln-Sm complex by the chaperone CLNS1A that controls the assembly of the core snRNP. Dissociation by the SMN complex of CLNS1A from the trapped Sm proteins and their transfer to an SMN-Sm complex triggers the assembly of core snRNPs and their transport to the nucleus.

Type

Protein

Source

E.coli

Sequence

MQTPVNIPVPVLRLPRGPDGFSRGFAPDGRRAPLRPEVPEIQECPIAQESLESQEQRARAALRERYLRSLLAMVGHQVSFTLHEGVRVAAHFGATDLDVANFYVSQLQTPIGVQAEALLRCSDIISYTFKP

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

41.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

GEMIN7

Host or Source

Human

Protein Name

Gem-associated protein 7

Gene Name URL

GEMIN7

Nucleotide Accession Number

NM_001007269.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR13C3 Protein Vector (Human) (pPB-N-His)
PV106127 500 ng

OR13C3 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Mouse Monoclonal Lewis Y Antibody (LWY/1463) [Janelia Fluor 549]
NBP2-54560JF549 0.1 mL

Mouse Monoclonal Lewis Y Antibody (LWY/1463) [Janelia Fluor 549]

Sign In for Pricing
View Details
SMYD3 Protein Lysate
OCOA02664-20UG 20 µg

SMYD3 Protein Lysate

Sign In for Pricing
View Details
FDFT Antibody
MBS9520066-01 0.04 mL

FDFT Antibody

Sign In for Pricing
View Details
FDFT Antibody
MBS9520066-02 0.1 mL

FDFT Antibody

Sign In for Pricing
View Details
FDFT Antibody
MBS9520066-03 0.2 mL

FDFT Antibody

Sign In for Pricing
View Details