Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDCD10 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Programmed cell death 10

Gene Aliases

Apoptosis-related protein 15; CCM3; cerebral cavernous malformations 3 protein; programmed cell death protein 10; TF-1 cell apoptosis-related protein 15; TFAR15.

Gene ID

11235

Accession Number

NP_009148.2

Reactivity

Homo sapiens|Human

Target

Promotes cell proliferation. Modulates apoptotic pathways. Increases mitogen-activated protein kinase activity and STK26 activity (PubMed:27807006) . Important for cell migration, and for normal structure and assembly of the Golgi complex (PubMed:27807006) . Important for KDR/VEGFR2 signaling. Increases the stability of KDR/VEGFR2 and prevents its breakdown. Required for normal cardiovascular development. Required for normal angiogenesis, vasculogenesis and hematopoiesis during embryonic development (By similarity) .

Type

Protein

Source

E.coli

Sequence

MRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

40.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PDCD10

Host or Source

Human

Protein Name

Programmed cell death protein 10

Gene Name URL

PDCD10

Nucleotide Accession Number

NM_007217.3

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRADC1 CRISPRa sgRNA lentivector (set of three targets)(Human)
37521121 3x 1.0µg DNA

PRADC1 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Recombinant Mouse AP5M1 Protein, His (Fc)-Avi-tagged
AP5M1-611M 50 µg

Recombinant Mouse AP5M1 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Rimegepant Impurity 43
RM-R102043-01 10 mg

Rimegepant Impurity 43

Sign In for Pricing
View Details
Rimegepant Impurity 43
RM-R102043-02 25 mg

Rimegepant Impurity 43

Sign In for Pricing
View Details
Rimegepant Impurity 43
RM-R102043-03 50 mg

Rimegepant Impurity 43

Sign In for Pricing
View Details
Rimegepant Impurity 43
RM-R102043-04 100 mg

Rimegepant Impurity 43

Sign In for Pricing
View Details